You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08512
Secondary Accession Numbers
  • 14224
Name Rab GTPase-binding effector protein 1
Synonyms
  1. Rabaptin-4
  2. Rabaptin-5
  3. Rabaptin-5alpha
  4. Renal carcinoma antigen NY-REN-17
Gene Name RABEP1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Rab effector protein acting as linker between gamma- adaptin, RAB4A and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
enzyme regulator activity
protein binding
receptor binding
growth factor activity
enzyme activator activity
gtpase activator activity
Cellular Location
  1. Cytoplasm
  2. Early endosome
  3. Recycling endosome
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.2
SNPs RABEP1
Gene Sequence
>2589 bp
ATGGCGCAGCCGGGCCCGGCTTCCCAGCCTGACGTTTCTCTTCAGCAACGGGTAGCAGAA
TTGGAAAAAATTAATGCAGAATTTTTACGTGCACAACAGCAGCTTGAACAAGAATTTAAT
CAAAAGAGAGCAAAATTTAAGGAGTTATATTTGGCTAAAGAGGAGGATCTGAAGAGGCAA
AATGCAGTATTACAAGCTGCACAAGATGATTTGGGACACCTTCGAACCCAGCTGTGGGAA
GCTCAAGCAGAGATGGAGAATATTAAGGCGATTGCCACAGTCTCTGAGAACACCAAGCAA
GAAGCTATAGATGAAGTGAAAAGACAGTGGAGAGAAGAAGTTGCTTCACTTCAGGCTGTT
ATGAAAGAAACAGTTCGTGACTATGAGCACCAGTTCCACCTTAGGCTGGAGCAGGAGCGA
ACACAGTGGGCACAGTATAGAGAATCCGCAGAGAGGGAAATAGCTGATTTAAGAAGAAGG
CTGTCTGAAGGTCAAGAGGAGGAAAATTTAGAAAATGAAATGAAAAAGGCCCAAGAGGAT
GCTGAGAAACTTCGGTCCGTTGTGATGCCAATGGAAAAGGAAATTGCAGCTTTGAAGGAT
AAACTGACAGAGGCTGAAGACAAAATTAAAGAGCTGGAGGCCTCAAAGGTTAAAGAACTG
AATCATTATCTGGAAGCTGAGAAATCTTGTAGGACTGATCTAGAGATGTATGTAGCTGTT
TTGAATACTCAGAAATCTGTTCTACAGGAAGATGCTGAGAAACTGCGGAAAGAATTGCAT
GAAGTTTGCCATCTCTTGGAGCAAGAGCGACAACAACACAACCAGTTAAAACATACGTGG
CAGAAGGCCAATGACCAGTTTCTGGAATCTCAGCGTTTACTGATGAGAGACATGCAGCGA
ATGGAGATTGTGCTAACTTCAGAACAGCTCCGACAAGTTGAAGAACTGAAGAAGAAAGAT
CAGGAGGATGATGAACAACAAAGACTCAATAAGAGAAAGGATCACAAAAAAGCAGATGTT
GAGGAAGAAATAAAAATACCAGTAGTGTGTGCTTTAACTCAAGAAGAATCTTCAGCCCAG
TTATCAAATGAAGAGGAGCATTTAGACAGCACCCGTGGCTCAGTTCATTCCTTAGATGCA
GGCTTGCTGTTGCCATCTGGAGATCCTTTCAGTAAATCGGACAATGACATGTTTAAAGAT
GGACTCAGGAGAGCACAGTCTACAGACAGCTTGGGAACCTCGGGCTCATTGCAATCCAAA
GCTTTAGGCTATAACTACAAAGCAAAATCTGCTGGAAACCTGGACGAGTCAGATTTTGGA
CCACTGGTAGGAGCAGATTCAGTGTCTGAGAACTTTGATACTGCATCCCTTGGGTCACTC
CAGATGCCAAGTGGGTTTATGTTAACCAAAGATCAGGAAAGAGCAATCAAGGCGATGACA
CCAGAACAAGAAGAGACAGCGTCCCTCCTCTCCAGCGTTACCCAGGGCATGGAGAGTGCC
TATGTGTCCCCTAGTGGTTATCGTTTAGTTAGTGAAACAGAATGGAATCTCTTGCAGAAA
GAGGTACATAATGCTGGAAATAAACTTGGTAGACGTTGTGATATGTGTTCCAATTACGAA
AAACAGTTACAAGGAATTCAGATTCAGGAGGCTGAAACGAGAGACCAGGTGAAAAAACTA
CAGCTGATGCTAAGGCAAGCTAATGACCAGTTAGAGAAGACAATGAAAGATAAGCAGGAG
CTGGAAGACTTCATAAAGCAAAGCAGCGAAGATTCGAGTCACCAGATCTCTGCACTCGTC
CTAAGAGCCCAGGCCTCCGAGATCTTACTTGAAGAGTTACAGCAGGGGCTTTCCCAGGCA
AAGAGGGATGTTCAGGAACAGATGGCGGTGCTGATGCAGTCACGGGAACAGGTTTCAGAA
GAGCTGGTGAGGTTACAGAAAGATAATGACAGTCTCCAGGGAAAGCACAGCCTGCATGTG
TCATTACAGCAAGCAGAAGACTTCATCCTCCCAGACACTACAGAGGCACTGCGGGAGTTG
GTATTAAAATACCGTGAGGACATCATTAATGTGCGGACAGCAGCAGACCACGTAGAAGAA
AAGCTGAAGGCTGAGATACTTTTCCTAAAAGAGCAGATCCAAGCAGAACAGTGTTTAAAA
GAAAATCTTGAAGAAACTCTGCAACTAGAAATAGAAAACTGCAAGGAGGAAATAGCTTCT
ATTTCTAGCCTAAAAGCTGAATTAGAAAGAATAAAAGTGGAAAAAGGACAGTTGGAGTCC
ACATTAAGAGAGAAGTCTCAACAGCTTGAGAGTCTTCAGGAAATAAAGATCAGTTTGGAA
GAGCAGTTAAAGAAAGAGACTGCTGCTAAGGCTACCGTTGAACAACTAATGTTTGAAGAG
AAGAATAAAGCTCAGAGATTACAGACAGAATTAGATGTCAGTGAGCAAGTCCAGAGGGAT
TTTGTAAAGCTTTCACAGACCCTTCAGGTGCAGTTAGAGCGGATCCGGCAAGCTGACTCC
TTGGAGAGAATCCGGGCAATTCTGAATGATACTAAACTGACAGACATTAACCAGCTTCCT
GAGACATGA
Protein Properties
Number of Residues 862
Molecular Weight 99289.7
Theoretical pI 4.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rab GTPase-binding effector protein 1
MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQ
NAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAV
MKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQED
AEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAV
LNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQR
MEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQ
LSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSK
ALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMT
PEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYE
KQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALV
LRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHV
SLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLK
ENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLE
EQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADS
LERIRAILNDTKLTDINQLPET
GenBank ID Protein 31377798
UniProtKB/Swiss-Prot ID Q15276
UniProtKB/Swiss-Prot Entry Name RABE1_HUMAN
PDB IDs
GenBank Gene ID NM_004703.4
GeneCard ID RABEP1
GenAtlas ID RABEP1
HGNC ID HGNC:17677
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jager D, Jager E, Knuth A, Chen YT, Old LJ: Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Int J Cancer. 1999 Nov 12;83(4):456-64. [PubMed:10508479 ]
  10. Mattera R, Arighi CN, Lodge R, Zerial M, Bonifacino JS: Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. EMBO J. 2003 Jan 2;22(1):78-88. [PubMed:12505986 ]
  11. Zhu G, Zhai P, Liu J, Terzyan S, Li G, Zhang XC: Structural basis of Rab5-Rabaptin5 interaction in endocytosis. Nat Struct Mol Biol. 2004 Oct;11(10):975-83. Epub 2004 Sep 19. [PubMed:15378032 ]
  12. Stenmark H, Vitale G, Ullrich O, Zerial M: Rabaptin-5 is a direct effector of the small GTPase Rab5 in endocytic membrane fusion. Cell. 1995 Nov 3;83(3):423-32. [PubMed:8521472 ]
  13. Nagelkerken B, Van Anken E, Van Raak M, Gerez L, Mohrmann K, Van Uden N, Holthuizen J, Pelkmans L, Van Der Sluijs P: Rabaptin4, a novel effector of the small GTPase rab4a, is recruited to perinuclear recycling vesicles. Biochem J. 2000 Mar 15;346 Pt 3:593-601. [PubMed:10698684 ]
  14. Horiuchi H, Lippe R, McBride HM, Rubino M, Woodman P, Stenmark H, Rybin V, Wilm M, Ashman K, Mann M, Zerial M: A novel Rab5 GDP/GTP exchange factor complexed to Rabaptin-5 links nucleotide exchange to effector recruitment and function. Cell. 1997 Sep 19;90(6):1149-59. [PubMed:9323142 ]
  15. Cosulich SC, Horiuchi H, Zerial M, Clarke PR, Woodman PG: Cleavage of rabaptin-5 blocks endosome fusion during apoptosis. EMBO J. 1997 Oct 15;16(20):6182-91. [PubMed:9321397 ]
  16. Xiao GH, Shoarinejad F, Jin F, Golemis EA, Yeung RS: The tuberous sclerosis 2 gene product, tuberin, functions as a Rab5 GTPase activating protein (GAP) in modulating endocytosis. J Biol Chem. 1997 Mar 7;272(10):6097-100. [PubMed:9045618 ]
  17. Lippe R, Miaczynska M, Rybin V, Runge A, Zerial M: Functional synergy between Rab5 effector Rabaptin-5 and exchange factor Rabex-5 when physically associated in a complex. Mol Biol Cell. 2001 Jul;12(7):2219-28. [PubMed:11452015 ]
  18. Deneka M, Neeft M, Popa I, van Oort M, Sprong H, Oorschot V, Klumperman J, Schu P, van der Sluijs P: Rabaptin-5alpha/rabaptin-4 serves as a linker between rab4 and gamma(1)-adaptin in membrane recycling from endosomes. EMBO J. 2003 Jun 2;22(11):2645-57. [PubMed:12773381 ]