Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08527
Secondary Accession Numbers
  • 14239
Name GTPase NRas
Synonyms
  1. Transforming protein N-Ras
Gene Name NRAS
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Ras proteins bind GDP/GTP and possess intrinsic GTPase activity
Pathways
  • Fc Epsilon Receptor I Signaling in Mast Cells
Reactions Not Available
GO Classification
Component
membrane
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Lipid-anchor
  4. Golgi apparatus membrane
  5. Cytoplasmic side
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.2
SNPs NRAS
Gene Sequence
>570 bp
ATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGAAAAGCGCACTGACA
ATCCAGCTAATCCAGAACCACTTTGTAGATGAATATGATCCCACCATAGAGGATTCTTAC
AGAAAACAAGTGGTTATAGATGGTGAAACCTGTTTGTTGGACATACTGGATACAGCTGGA
CAAGAAGAGTACAGTGCCATGAGAGACCAATACATGAGGACAGGCGAAGGCTTCCTCTGT
GTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTAACCTCTACAGGGAGCAGATT
AAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAAACAAGTGTGATTTG
CCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGAGTTACGGGATTCCA
TTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTTTTTACACACTGGTA
AGAGAAATACGCCAGTACCGAATGAAAAAACTCAACAGCAGTGATGATGGGACTCAGGGT
TGTATGGGATTGCCATGTGTGGTGATGTAA
Protein Properties
Number of Residues 189
Molecular Weight 21229.0
Theoretical pI 4.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GTPase NRas
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
GenBank ID Protein 20147731
UniProtKB/Swiss-Prot ID P01111
UniProtKB/Swiss-Prot Entry Name RASN_HUMAN
PDB IDs Not Available
GenBank Gene ID AF493919
GeneCard ID NRAS
GenAtlas ID NRAS
HGNC ID HGNC:7989
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Hancock JF, Magee AI, Childs JE, Marshall CJ: All ras proteins are polyisoprenylated but only some are palmitoylated. Cell. 1989 Jun 30;57(7):1167-77. [PubMed:2661017 ]
  4. Swarthout JT, Lobo S, Farh L, Croke MR, Greentree WK, Deschenes RJ, Linder ME: DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras. J Biol Chem. 2005 Sep 2;280(35):31141-8. Epub 2005 Jul 6. [PubMed:16000296 ]
  5. Rocks O, Peyker A, Kahms M, Verveer PJ, Koerner C, Lumbierres M, Kuhlmann J, Waldmann H, Wittinghofer A, Bastiaens PI: An acylation cycle regulates localization and activity of palmitoylated Ras isoforms. Science. 2005 Mar 18;307(5716):1746-52. Epub 2005 Feb 10. [PubMed:15705808 ]
  6. Taparowsky E, Shimizu K, Goldfarb M, Wigler M: Structure and activation of the human N-ras gene. Cell. 1983 Sep;34(2):581-6. [PubMed:6616621 ]
  7. Hall A, Brown R: Human N-ras: cDNA cloning and gene structure. Nucleic Acids Res. 1985 Jul 25;13(14):5255-68. [PubMed:2991860 ]
  8. Brown R, Marshall CJ, Pennie SG, Hall A: Mechanism of activation of an N-ras gene in the human fibrosarcoma cell line HT1080. EMBO J. 1984 Jun;3(6):1321-6. [PubMed:6086315 ]
  9. Yuasa Y, Gol RA, Chang A, Chiu IM, Reddy EP, Tronick SR, Aaronson SA: Mechanism of activation of an N-ras oncogene of SW-1271 human lung carcinoma cells. Proc Natl Acad Sci U S A. 1984 Jun;81(12):3670-4. [PubMed:6587382 ]
  10. Hirai H, Tanaka S, Azuma M, Anraku Y, Kobayashi Y, Fujisawa M, Okabe T, Urabe A, Takaku F: Transforming genes in human leukemia cells. Blood. 1985 Dec;66(6):1371-8. [PubMed:2998510 ]
  11. Yuasa Y, Kamiyama T, Kato M, Iwama T, Ikeuchi T, Tonomura A: Transforming genes from familial adenomatous polyposis patient cells detected by a tumorigenicity assay. Oncogene. 1990 Apr;5(4):589-96. [PubMed:1970154 ]
  12. Gambke C, Hall A, Moroni C: Activation of an N-ras gene in acute myeloblastic leukemia through somatic mutation in the first exon. Proc Natl Acad Sci U S A. 1985 Feb;82(3):879-82. [PubMed:3856237 ]
  13. Hirai H, Kobayashi Y, Mano H, Hagiwara K, Maru Y, Omine M, Mizoguchi H, Nishida J, Takaku F: A point mutation at codon 13 of the N-ras oncogene in myelodysplastic syndrome. Nature. 1987 Jun 4-10;327(6121):430-2. [PubMed:3295562 ]
  14. Raybaud F, Noguchi T, Marics I, Adelaide J, Planche J, Batoz M, Aubert C, de Lapeyriere O, Birnbaum D: Detection of a low frequency of activated ras genes in human melanomas using a tumorigenicity assay. Cancer Res. 1988 Feb 15;48(4):950-3. [PubMed:3276402 ]
  15. Nitta N, Ochiai M, Nagao M, Sugimura T: Amino-acid substitution at codon 13 of the N-ras oncogene in rectal cancer in a Japanese patient. Jpn J Cancer Res. 1987 Jan;78(1):21-6. [PubMed:3102434 ]
  16. Oliveira JB, Bidere N, Niemela JE, Zheng L, Sakai K, Nix CP, Danner RL, Barb J, Munson PJ, Puck JM, Dale J, Straus SE, Fleisher TA, Lenardo MJ: NRAS mutation causes a human autoimmune lymphoproliferative syndrome. Proc Natl Acad Sci U S A. 2007 May 22;104(21):8953-8. Epub 2007 May 16. [PubMed:17517660 ]
  17. Cirstea IC, Kutsche K, Dvorsky R, Gremer L, Carta C, Horn D, Roberts AE, Lepri F, Merbitz-Zahradnik T, Konig R, Kratz CP, Pantaleoni F, Dentici ML, Joshi VA, Kucherlapati RS, Mazzanti L, Mundlos S, Patton MA, Silengo MC, Rossi C, Zampino G, Digilio C, Stuppia L, Seemanova E, Pennacchio LA, Gelb BD, Dallapiccola B, Wittinghofer A, Ahmadian MR, Tartaglia M, Zenker M: A restricted spectrum of NRAS mutations causes Noonan syndrome. Nat Genet. 2010 Jan;42(1):27-9. doi: 10.1038/ng.497. Epub 2009 Dec 6. [PubMed:19966803 ]