You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08532
Secondary Accession Numbers
  • 14244
Name Rabenosyn-5
Synonyms
  1. 110 kDa protein
  2. FYVE finger-containing Rab5 effector protein rabenosyn-5
  3. Zinc finger FYVE domain-containing protein 20
Gene Name ZFYVE20
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Rab4/Rab5 effector protein acting in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Required for endosome fusion either homotypically or with clathrin coated vesicles. Plays a role in the lysosomal trafficking of CTSD/cathepsin D from the Golgi to lysosomes. Also promotes the recycling of transferrin directly from early endosomes to the plasma membrane. Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate (PtdInsP3)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Lipid-anchor
  4. Cytoplasmic side
  5. Early endosome membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3p25.1
SNPs ZFYVE20
Gene Sequence
>2355 bp
ATGGCTTCTCTGGACGACCCAGGGGAAGTGAGGGAGGGCTTCCTCTGCCCTCTGTGCCTG
AAGGATCTGCAGTCTTTCTATCAGCTTCACTCACATTACGAGGAAGAACACTCAGGGGAA
GACCGTGATGTCAAAGGGCAAATTAAAAGTCTTGTCCAGAAGGCTAAAAAAGCAAAGGAC
AGGTTGTTGAAACGAGAAGGGGATGATCGAGCAGAGTCAGGGACCCAAGGATATGAGTCT
TTCAGCTATGGAGGGGTTGATCCTTACATGTGGGAACCCCAGGAGCTTGGTGCTGTGAGA
AGCCATCTTTCCGACTTCAAAAAACACCGAGCTGCTAGAATTGACCACTATGTTGTGGAA
GTCAATAAACTAATAATCAGGTTAGAGAAGCTCACTGCATTTGACAGAACAAATACTGAG
TCTGCAAAGATTCGAGCAATAGAAAAGTCTGTGGTGCCTTGGGTCAACGACCAGGATGTC
CCTTTCTGTCCAGACTGTGGGAATAAGTTCAGCATCCGGAACCGCCGCCACCACTGCCGC
CTCTGCGGGTCTATTATGTGCAAGAAGTGTATGGAGCTCATCAGCCTTCCCTTGGCAAAC
AAGCTCACCAGTGCCAGCAAGGAGTCCCTGAGCACCCACACCAGCCCCAGCCAGTCACCC
AACAGTGTCCATGGCTCCCGCCGAGGCAGCATCAGCAGCATGAGCAGTGTCAGCTCGGTC
CTGGATGAGAAGGACGATGACCGGATCCGCTGCTGTACACACTGCAAGGACACGCTGCTC
AAGAGAGAGCAGCAGATTGATGAGAAGGAGCACACACCTGACATCGTGAAGCTCTACGAG
AAATTACGACTTTGCATGGAGAAAGTTGACCAGAAAGCTCCAGAATACATCAGGATGGCA
GCATCATTAAATGCTGGGGAGACAACCTACAGTCTGGAACATGCCAGTGACCTTCGAGTG
GAAGTGCAGAAAGTGTATGAGCTGATAGACGCTTTAAGTAAGAAGATCTTAACCTTGGGC
TTGAACCAGGACCCTCCACCACATCCAAGCAATTTGCGGCTGCAGAGAATGATCAGATAC
TCAGCTACACTTTTTGTGCAGGAAAAGTTGCTTGGTTTGATGTCACTGCCAACCAAAGAA
CAGTTTGAGGAACTGAAAAAGAAAAGGAAGGAGGAAATGGAGAGGAAGAGGGCCGTGGAG
AGACAAGCTGCCCTGGAGTCCCAGCGAAGGCTTGAGGAAAGGCAGAGTGGCCTGGCTTCT
CGAGCGGCCAACGGGGAGGTGGCATCTCTCCGCAGGGGCCCTGCCCCCTTGAGAAAGGCT
GAGGGCTGGCTCCCACTGTCAGGAGGTCAGGGGCAGAGTGAGGACTCAGACCCGCTCCTC
CAGCAGATCCACAACATCACATCATTCATCAGGCAGGCCAAGGCCGCGGGCCGCATGGAT
GAAGTGCGCACTCTGCAGGAGAACCTGCGGCAGCTGCAGGACGAGTATGACCAGCAGCAG
ACAGAGAAGGCCATCGAGCTGTCCCGGAGGCAGGCTGAGGAGGAGGACCTGCAGCGGGAA
CAGCTGCAGATGTTGCGTGAACGGGAGTTGGAACGAGAAAGGGAGCAGTTTCGGGTGGCA
TCCCTGCACACACGGACTCGGTCCCTGGACTTCAGAGAAATCGGCCCTTTTCAGCTGGAG
CCCAGCAGAGAGCCTCGCACCCACCTTGCTTATGCTTTGGATCTAGGCTCTTCCCCAGTT
CCAAGCAGCACAGCTCCCAAGACCCCTTCACTTAGCTCAACTCAACCCACCAGAGTGTGG
TCTGGGCCCCCAGCCGTTGGCCAGGAGCGCTTACCCCAGAGCAGCATGCCACAGCAACAT
GAGGGGCCCTCCTTAAACCCCTTTGATGAGGAAGACCTCTCCAGCCCCATGGAAGAGGCC
ACTACTGGTCCTCCTGCTGCAGGGGTTTCCTTAGACCCTTCAGCCCGCATCCTGAAAGAG
TACAATCCTTTCGAGGAAGAGGACGAGGAGGAGGAAGCAGTGGCAGGGAATCCATTCATT
CAGCCAGACAGCCCAGCTCCTAACCCCTTCAGTGAGGAAGACGAACATCCCCAGCAGAGG
CTCTCAAGCCCTCTGGTTCCTGGTAACCCCTTTGAGGAACCCACCTGTATCAACCCCTTT
GAGATGGACAGTGACAGTGGGCCAGAGGCTGAGGAGCCCATAGAGGAAGAGCTCCTCCTG
CAGCAGATCGATAACATCAAGGCATACATCTTTGATGCCAAGCAGTGCGGCCGCCTGGAT
GAGGTAGAGGTGCTGACAGAGAATCTGCGGGAGCTGAAGCACACCCTGGCCAAGCAGAAG
GGGGGCACTGACTGA
Protein Properties
Number of Residues 784
Molecular Weight 88868.8
Theoretical pI 5.19
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rabenosyn-5
MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKD
RLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVE
VNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCR
LCGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSV
LDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMA
ASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRY
SATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLAS
RAANGEVASLRRGPAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMD
EVRTLQENLRQLQDEYDQQQTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVA
SLHTRTRSLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSSTAPKTPSLSSTQPTRVW
SGPPAVGQERLPQSSMPQQHEGPSLNPFDEEDLSSPMEEATTGPPAAGVSLDPSARILKE
YNPFEEEDEEEEAVAGNPFIQPDSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPF
EMDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQK
GGTD
GenBank ID Protein 70980547
UniProtKB/Swiss-Prot ID Q9H1K0
UniProtKB/Swiss-Prot Entry Name RBNS5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022340.2
GeneCard ID ZFYVE20
GenAtlas ID ZFYVE20
HGNC ID HGNC:20759
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M: Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain. J Cell Biol. 2000 Oct 30;151(3):601-12. [PubMed:11062261 ]
  7. Eathiraj S, Pan X, Ritacco C, Lambright DG: Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Nature. 2005 Jul 21;436(7049):415-9. [PubMed:16034420 ]
  8. de Renzis S, Sonnichsen B, Zerial M: Divalent Rab effectors regulate the sub-compartmental organization and sorting of early endosomes. Nat Cell Biol. 2002 Feb;4(2):124-33. [PubMed:11788822 ]
  9. Naslavsky N, Boehm M, Backlund PS Jr, Caplan S: Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane. Mol Biol Cell. 2004 May;15(5):2410-22. Epub 2004 Mar 12. [PubMed:15020713 ]