You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08610
Secondary Accession Numbers
  • 14325
Name Transportin-1
Synonyms
  1. Importin beta-2
  2. Karyopherin beta-2
  3. M9 region interaction protein
  4. MIP
Gene Name TNPO1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in nuclear import of M9- containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Appears also to be involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones, and SRP19. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q13.2
SNPs TNPO1
Gene Sequence
>2697 bp
ATGGTGTGGGACCGGCAAACCAAGATGGAGTATGAGTGGAAACCTGACGAGCAAGGGCTT
CAGCAAATCCTGCAGCTGTTGAAGGAGTCCCAGTCCCCAGACACCACCATCCAGAGAACC
GTGCAACAAAAACTGGAACAACTTAATCAGTATCCAGACTTTAACAACTACTTGATTTTT
GTTCTTACAAAATTAAAATCTGAAGATGAACCCACAAGATCATTGAGTGGTCTTATCTTG
AAGAATAATGTGAAAGCACACTTTCAGAACTTCCCAAATGGTGTAACAGACTTTATTAAA
AGTGAATGTTTAAATAATATTGGTGACTCCTCTCCTCTGATTAGAGCCACTGTTGGTATT
TTGATCACAACTATAGCCTCCAAGGGAGAATTGCAGAATTGGCCTGACCTCTTACCAAAA
CTCTGTAGCCTGTTGGATTCTGAAGATTATAATACCTGTGAGGGAGCATTTGGTGCCCTT
CAGAAGATTTGTGAAGATTCTGCTGAGATTTTAGACAGTGATGTTTTAGATCGTCCTCTC
AACATCATGATTCCCAAATTTTTACAGTTCTTCAAGCATAGTAGTCCAAAAATAAGGTCT
CACGCTGTTGCATGTGTCAATCAGTTTATCATCAGTAGGACTCAAGCTCTAATGTTGCAC
ATTGATTCTTTTATTGAGAATCTCTTTGCATTAGCTGGTGATGAAGAACCAGAGGTACGG
AAAAATGTGTGCCGAGCACTTGTGATGTTGCTCGAAGTTCGAATGGATCGCCTGCTTCCT
CACATGCATAATATAGTTGAGTACATGCTACAGAGGACTCAAGATCAAGATGAAAATGTG
GCTTTAGAAGCCTGTGAATTTTGGCTAACTTTAGCTGAACAGCCAATATGCAAAGATGTA
CTCGTAAGGCATCTTCCTAAGTTGATTCCTGTGTTAGTGAATGGCATGAAGTACTCAGAC
ATAGATATTATCCTACTTAAGGGTGATGTTGAAGAAGACGAAACGATTCCTGATAGTGAA
CAGGATATACGGCCACGTTTTCACCGATCGAGGACGGTGGCTCAGCAGCATGATGAAGAT
GGAATTGAAGAGGAAGATGATGATGATGATGAAATTGATGATGATGATACAATTTCTGAC
TGGAATCTAAGAAAATGTTCTGCTGCTGCCCTGGATGTTCTTGCAAATGTGTATCGTGAT
GAACTGCTGCCACATATTTTGCCCCTTTTGAAAGAATTACTTTTTCATCATGAATGGGTT
GTTAAAGAATCAGGCATTTTGGTTTTAGGAGCAATTGCTGAAGGTTGCATGCAGGGCATG
ATTCCATACTTGCCTGAGCTTATTCCTCACCTTATTCAGTGCCTCTCTGATAAAAAGGCT
CTTGTGCGTTCCATAACATGCTGGACTCTTAGCCGCTATGCACACTGGGTGGTCAGCCAG
CCGCCAGACACGTACCTGAAGCCATTAATGACAGAATTGCTAAAGCGCATCCTGGACAGC
AACAAGAGAGTACAAGAAGCTGCCTGCAGTGCCTTTGCTACCCTAGAAGAGGAGGCTTGT
ACAGAACTTGTTCCTTACCTTGCTTATATACTTGATACCCTGGTCTTTGCATTTAGTAAA
TACCAGCATAAGAACCTGCTCATTCTTTACGATGCCATAGGAACATTAGCAGATTCAGTA
GGACATCATTTAAACAAACCAGAATATATTCAGATGCTAATGCCTCCACTGATCCAGAAA
TGGAACATGTTAAAGGATGAAGATAAAGATCTCTTCCCTTTACTTGAGTGCCTATCTTCA
GTTGCCACAGCACTGCAGTCTGGATTCCTTCCGTACTGTGAACCTGTGTATCAGCGTTGT
GTAAACCTAGTACAGAAGACTCTTGCACAAGCCATGCTAAACAATGCTCAACCAGATCAA
TATGAAGCTCCAGATAAAGATTTTATGATAGTGGCTCTTGATTTACTGAGTGGCCTGGCT
GAAGGACTTGGAGGCAACATTGAACAGCTGGTAGCCCGAAGTAACATCCTGACACTAATG
TATCAGTGCATGCAGGATAAAATGCCAGAAGTTCGACAGAGTTCTTTTGCCCTGTTAGGT
GACCTCACAAAAGCTTGCTTTCAGCATGTTAAGCCTTGTATAGCTGATTTCATGCCAATA
TTGGGAACCAACCTAAATCCAGAATTCATTTCAGTCTGCAACAATGCCACATGGGCAATT
GGAGAAATCTCCATTCAAATGGGTATAGAGATGCAGCCTTATATTCCTATGGTGTTGCAC
CAGCTTGTAGAAATCATTAACAGACCCAACACACCAAAGACGTTGTTAGAGAATACAGCA
ATAACAATTGGTCGTCTTGGTTACGTTTGTCCTCAAGAGGTGGCCCCCATGCTACAGCAG
TTTATAAGACCCTGGTGCACCTCTCTGAGAAACATAAGAGACAATGAGGAAAAGGATTCA
GCATTCCGTGGAATTTGTACCATGATCAGTGTGAATCCCAGTGGCGTAATCCAAGATTTT
ATATTTTTTTGTGATGCCGTTGCATCATGGATTAACCCAAAAGATGATCTCAGAGACATG
TTCTGTAAGATCCTTCATGGATTTAAAAATCAAGTTGGCGATGAAAATTGGAGGCGTTTC
TCTGACCAGTTTCCTCTTCCCTTAAAAGAGCGTCTTGCAGCTTTTTATGGTGTTTAA
Protein Properties
Number of Residues 898
Molecular Weight 102354.0
Theoretical pI 4.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Transportin-1
MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIF
VLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGI
LITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPL
NIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVR
KNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDV
LVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDED
GIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWV
VKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQ
PPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSK
YQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSS
VATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLA
EGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPI
LGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTA
ITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDF
IFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV
GenBank ID Protein 133925811
UniProtKB/Swiss-Prot ID Q92973
UniProtKB/Swiss-Prot Entry Name TNPO1_HUMAN
PDB IDs
GenBank Gene ID NM_002270.3
GeneCard ID TNPO1
GenAtlas ID TNPO1
HGNC ID HGNC:6401
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  6. Chook YM, Blobel G: Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp. Nature. 1999 May 20;399(6733):230-7. [PubMed:10353245 ]
  7. Jakel S, Gorlich D: Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells. EMBO J. 1998 Aug 3;17(15):4491-502. [PubMed:9687515 ]
  8. Arnold M, Nath A, Hauber J, Kehlenbach RH: Multiple importins function as nuclear transport receptors for the Rev protein of human immunodeficiency virus type 1. J Biol Chem. 2006 Jul 28;281(30):20883-90. Epub 2006 May 16. [PubMed:16704975 ]
  9. Dean KA, von Ahsen O, Gorlich D, Fried HM: Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin. J Cell Sci. 2001 Oct;114(Pt 19):3479-85. [PubMed:11682607 ]
  10. Pollard VW, Michael WM, Nakielny S, Siomi MC, Wang F, Dreyfuss G: A novel receptor-mediated nuclear protein import pathway. Cell. 1996 Sep 20;86(6):985-94. [PubMed:8808633 ]
  11. Bonifaci N, Moroianu J, Radu A, Blobel G: Karyopherin beta2 mediates nuclear import of a mRNA binding protein. Proc Natl Acad Sci U S A. 1997 May 13;94(10):5055-60. [PubMed:9144189 ]
  12. Nakielny S, Siomi MC, Siomi H, Michael WM, Pollard V, Dreyfuss G: Transportin: nuclear transport receptor of a novel nuclear protein import pathway. Exp Cell Res. 1996 Dec 15;229(2):261-6. [PubMed:8986607 ]
  13. Doi A, Shiosaka T, Takaoka Y, Yanagisawa K, Fujita S: Molecular cloning of the cDNA encoding A + U-rich element RNA binding factor. Biochim Biophys Acta. 1998 Mar 4;1396(1):51-6. [PubMed:9524220 ]