You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08638
Secondary Accession Numbers
  • 14354
Name Cytochrome P450 2U1
Synonyms Not Available
Gene Name CYP2U1
Protein Type Unknown
Biological Properties
General Function Involved in monooxygenase activity
Specific Function Catalyzes the hydroxylation of arachidonic acid, docosahexaenoic acid and other long chain fatty acids. May modulate the arachidonic acid signaling pathway and play a role in other fatty acid signaling processes.
Pathways
  • Acetaminophen Action Pathway
  • Acetylsalicylic Acid Action Pathway
  • Antipyrine Action Pathway
  • Antrafenine Action Pathway
  • Arachidonic acid metabolism
  • Arachidonic Acid Metabolism
  • Bromfenac Action Pathway
  • Carprofen Action Pathway
  • Celecoxib Action Pathway
  • Diclofenac Action Pathway
  • Diflunisal Action Pathway
  • Etodolac Action Pathway
  • Etoricoxib Action Pathway
  • Fenoprofen Action Pathway
  • Flurbiprofen Action Pathway
  • Ibuprofen Action Pathway
  • Indomethacin Action Pathway
  • Ketoprofen Action Pathway
  • Ketorolac Action Pathway
  • Leukotriene C4 Synthesis Deficiency
  • Lornoxicam Action Pathway
  • Lumiracoxib Action Pathway
  • Magnesium salicylate Action Pathway
  • Mefenamic Acid Action Pathway
  • Meloxicam Action Pathway
  • Nabumetone Action Pathway
  • Naproxen Action Pathway
  • Nepafenac Action Pathway
  • Oxaprozin Action Pathway
  • Phenylbutazone Action Pathway
  • Piroxicam Action Pathway
  • Rofecoxib Action Pathway
  • Salicylate-sodium Action Pathway
  • Salicylic Acid Action Pathway
  • Salsalate Action Pathway
  • Sulindac Action Pathway
  • Suprofen Action Pathway
  • Tenoxicam Action Pathway
  • Tiaprofenic Acid Action Pathway
  • Tolmetin Action Pathway
  • Trisalicylate-choline Action Pathway
  • Valdecoxib Action Pathway
Reactions
RH + reduced flavoprotein + Oxygen → ROH + oxidized flavoprotein + Water details
GO Classification
Biological Process
small molecule metabolic process
xenobiotic metabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
oxidoreductase activity
Molecular Function
electron carrier activity
aromatase activity
iron ion binding
heme binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
  3. Microsome membrane
Gene Properties
Chromosome Location 4
Locus 4q25
SNPs CYP2U1
Gene Sequence
>1635 bp
ATGTCGTCTCCGGGGCCGTCGCAGCCGCCGGCCGAGGACCCGCCCTGGCCCGCGCGCCTC
CTGCGTGCGCCTCTGGGGCTGCTGCGGCTGGACCCCAGCGGGGGCGCGCTGCTGCTATGC
GGCCTCGTAGCGCTGCTGGGCTGGAGCTGGCTGCGGAGGCGCCGGGCGCGGGGCATCCCG
CCCGGGCCCACGCCCTGGCCTCTGGTGGGCAACTTCGGTCACGTGCTGCTGCCTCCCTTC
CTCCGGCGGCGGAGCTGGCTGAGCAGCAGGACCAGGGCCGCAGGGATTGATCCCTCGGTC
ATAGGCCCGCAGGTGCTCCTGGCTCACCTAGCCCGCGTGTACGGCAGCATCTTCAGCTTC
TTTATCGGCCACTACCTGGTGGTGGTCCTCAGCGACTTCCACAGCGTGCGCGAGGCGCTG
GTGCAGCAGGCCGAGGTCTTCAGCGACCGCCCGCGGGTGCCGCTCATCTCCATCGTGACC
AAGGAGAAGGGGGTTGTGTTTGCACATTATGGTCCCGTCTGGAGACAACAAAGGAAGTTC
TCTCATTCAACTCTTCGTCATTTTGGGTTGGGAAAACTTAGCTTGGAGCCCAAGATTATT
GAGGAGTTCAAATATGTGAAAGCAGAAATGCAAAAGCACGGAGAAGACCCCTTCTGTCCT
TTCTCCATCATCAGCAATGCCGTCTCTAACATCATTTGCTCCTTGTGCTTTGGCCAGCGC
TTTGATTACACTAATAGTGAGTTCAAGAAAATGCTTGGTTTTATGTCACGAGGCCTAGAA
ATCTGTCTGAACAGTCAAGTCCTCCTGGTCAACATATGCCCTTGGCTTTATTACCTTCCC
TTTGGACCATTTAAGGAATTAAGACAAATTGAAAAGGATATAACCAGTTTCCTTAAAAAA
ATCATCAAAGACCATCAAGAGTCTCTGGATAGAGAGAACCCTCAGGACTTCATAGACATG
TACCTTCTCCACATGGAAGAGGAGAGGAAAAATAATAGTAACAGCAGTTTTGATGAAGAG
TACTTATTTTATATCATTGGGGATCTCTTTATTGCTGGGACTGATACCACAACTAACTCT
TTGCTCTGGTGCCTGCTGTATATGTCGCTGAACCCCGATGTACAAGAAAAGGTTCATGAA
GAAATTGAAAGAGTCATTGGCGCCAACCGAGCTCCTTCCCTCACAGACAAGGCCCAGATG
CCCTACACAGAAGCCACCATCATGGAAGTGCAGAGGCTAACTGTGGTGGTGCCGCTTGCC
ATTCCTCATATGACCTCAGAGAACACAGTGCTCCAAGGGTATACCATTCCTAAAGGCACA
TTGATCTTACCCAACCTGTGGTCAGTACATAGAGACCCAGCCATTTGGGAGAAACCGGAG
GATTTCTACCCTAATCGATTTCTGGATGACCAAGGACAACTAATTAAAAAAGAAACCTTT
ATTCCTTTTGGGATAGGGAAGCGGGTGTGTATGGGAGAACAACTGGCAAAGATGGAATTA
TTCCTAATGTTTGTGAGCCTAATGCAGAGTTTCGCATTTGCTTTACCTGAGGATTCTAAG
AAGCCCCTCCTGACTGGAAGATTTGGTCTAACTTTAGCCCCACATCCATTTAATATAACT
ATTTCAAGGAGATGA
Protein Properties
Number of Residues 544
Molecular Weight 61986.525
Theoretical pI 8.391
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 2U1
MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIP
PGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSF
FIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKF
SHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQR
FDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKK
IIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNS
LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETF
IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNIT
ISRR
GenBank ID Protein 33521674
UniProtKB/Swiss-Prot ID Q7Z449
UniProtKB/Swiss-Prot Entry Name CP2U1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY343323
GeneCard ID CYP2U1
GenAtlas ID CYP2U1
HGNC ID HGNC:20582
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chuang SS, Helvig C, Taimi M, Ramshaw HA, Collop AH, Amad M, White JA, Petkovich M, Jones G, Korczak B: CYP2U1, a novel human thymus- and brain-specific cytochrome P450, catalyzes omega- and (omega-1)-hydroxylation of fatty acids. J Biol Chem. 2004 Feb 20;279(8):6305-14. Epub 2003 Dec 3. [PubMed:14660610 ]
  3. Karlgren M, Backlund M, Johansson I, Oscarson M, Ingelman-Sundberg M: Characterization and tissue distribution of a novel human cytochrome P450-CYP2U1. Biochem Biophys Res Commun. 2004 Mar 12;315(3):679-85. [PubMed:14975754 ]
  4. Choudhary D, Jansson I, Stoilov I, Sarfarazi M, Schenkman JB: Expression patterns of mouse and human CYP orthologs (families 1-4) during development and in different adult tissues. Arch Biochem Biophys. 2005 Apr 1;436(1):50-61. [PubMed:15752708 ]