You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08640
Secondary Accession Numbers
  • 14356
Name Cytochrome P450 4F22
Synonyms Not Available
Gene Name CYP4F22
Protein Type Unknown
Biological Properties
General Function Involved in monooxygenase activity
Specific Function Not Available
Pathways
  • Arachidonic acid metabolism
Reactions
Leukotriene B4 + NADPH + Hydrogen Ion + Oxygen → 20-Hydroxy-leukotriene B4 + NADP + Water details
Arachidonic acid + Oxygen + NADPH + Hydrogen Ion → 20-Hydroxyeicosatetraenoic acid + NADP + Water details
GO Classification
Cellular Component
endoplasmic reticulum membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity
Molecular Function
electron carrier activity
monooxygenase activity
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
heme binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endoplasmic reticulum membrane
  4. Microsome membrane
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs CYP4F22
Gene Sequence
>1596 bp
ATGCTGCCCATCACAGACCGCCTGCTGCACCTCCTGGGGCTGGAGAAGACGGCGTTCCGC
ATATACGCGGTGTCCACCCTTCTCCTCTTCCTGCTCTTCTTCCTGTTCCGCCTGCTGCTG
CGGTTCCTGAGGCTCTGCAGGAGCTTCTACATCACCTGCCGCCGGCTGCGCTGCTTCCCC
CAGCCTCCCCGGCGCAACTGGCTGCTGGGCCACCTGGGCATGTACCTTCCAAATGAGGCG
GGCCTTCAAGATGAGAAGAAGGTACTGGACAACATGCACCATGTACTCTTGGTATGGATG
GGACCTGTCCTGCCGCTGTTGGTTCTGGTGCACCCTGATTACATCAAACCCCTTTTGGGA
GCCTCAGCTGCCACCGCCCCCAAGGATGACCTCTTCTATGGCTTCCTAAAACCTTGGCTA
GGGGATGGGCTGCTGCTCAGCAAAGGTGACAAGTGGAGCCGGCACCGTCGCCTGCTGACA
CCCGCCTTCCACTTTGACATCCTGAAGCCTTACATGAAGATCTTCAACCAGAGCGCTGAC
ATTATGCATGCTAAATGGCGGCATCTGGCAGAGGGCTCAGCGGTCTCCCTTGATATGTTT
GAGCATATCAGCCTCATGACCCTGGACAGTCTTCAGAAATGTGTCTTCAGCTACAACAGC
AACTGCCAAGAGAAGATGAGTGATTATATCTCCGCTATCATTGAACTGAGCGCTCTGTCT
GTCCGGCGCCAGTATCGCTTGCACCACTACCTCGACTTCATTTACTACCGCTCGGCGGAT
GGGCGGAGGTTCCGGCAGGCCTGTGACATGGTGCACCACTTCACCACTGAAGTCATCCAG
GAACGGCGGCGGGCACTGCGTCGGCAGGGGGCCGAGGCCTGGCTTAAGGCCAAGCAGGGG
AAGACCTTGGACTTTATTGATGTGCTGCTCCTGGCCAGGGATGAAGATGGAAAGGAACTG
TCAGACGAGGATATCCGAGCCGAAGCAGACACCTTCATGTTTGAGGGTCACGACACAACA
TCCAGTGGGATCTCTTGGATGCTGTTCAATTTGGCAAAGTATCCGGAATACCAGGAGAAA
TGCCGAGAAGAGATTCAGGAAGTCATGAAAGGCCGGGAGCTGGAGGAGCTGGAGTGGGAC
GATCTGACTCAGCTGCCCTTTACAACTATGTGCATTAAGGAGAGCCTGCGCCAGTACCCA
CCTGTCACTCTTGTCTCTCGCCAATGCACGGAGGACATCAAGCTCCCAGATGGGCGCATC
ATCCCCAAAGGAATCATCTGCTTGGTCAGCATCTATGGAACCCACCACAACCCCACAGTG
TGGCCTGACTCCAAGGTGTACAACCCCTACCGCTTTGACCCGGACAACCCACAGCAGCGC
TCTCCACTGGCCTATGTGCCCTTCTCTGCAGGACCCAGGAATTGCATCGGACAGAGCTTC
GCCATGGCCGAGTTGCGCGTGGTTGTGGCACTAACACTGCTACGTTTCCGCCTGAGCGTG
GACCGAACGCGCAAGGTGCGGCGGAAGCCGGAGCTCATACTGCGCACGGAGAACGGGCTC
TGGCTCAAGGTGGAGCCGCTGCCTCCGCGGGCCTGA
Protein Properties
Number of Residues 531
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 4F22
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFP
QPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLG
ASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSAD
IMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALS
VRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQG
KTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEK
CREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRI
IPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSF
AMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
GenBank ID Protein 21756395
UniProtKB/Swiss-Prot ID Q6NT55
UniProtKB/Swiss-Prot Entry Name CP4FN_HUMAN
PDB IDs Not Available
GenBank Gene ID AK096820
GeneCard ID CYP4F22
GenAtlas ID CYP4F22
HGNC ID HGNC:26820
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Lefevre C, Bouadjar B, Ferrand V, Tadini G, Megarbane A, Lathrop M, Prud'homme JF, Fischer J: Mutations in a new cytochrome P450 gene in lamellar ichthyosis type 3. Hum Mol Genet. 2006 Mar 1;15(5):767-76. Epub 2006 Jan 25. [PubMed:16436457 ]