Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08714
Secondary Accession Numbers
  • 14436
Name Crossover junction endonuclease EME1
Synonyms
  1. MMS4 homolog
  2. hMMS4
Gene Name EME1
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'- flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
protein binding
nucleic acid binding
dna binding
nuclease activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
Cellular Location
  1. Nucleus
  2. nucleolus
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21.33
SNPs EME1
Gene Sequence
>1713 bp
ATGGCTCTAAAGAAGTCATCACCCTCACTGGATTCTGGTGATAGTGACTCTGAGGAGTTG
CCAACATTTGCCTTTCTGAAGAAGGAACCATCTTCAACAAAGAGGAGACAGCCTGAAAGG
GAAGAGAAGATTGTAGTGGTTGACATCTCAGATTGTGAAGCCTCCTGTCCTCCAGCACCA
GAGTTATTTTCACCACCTGTCCCAGACATAGCTGAAACTGTCACACAAACACAGCCAGTC
AGGTTGCTAAGCAGTGAAAGTGAAGATGAAGAAGAATTTATTCCTCTGGCTCAAAGGCTT
ACATGTAAGTTTCTGACCCACAAGCAACTGAGCCCTGAGGACTCTAGCTCCCCAGTTAAA
AGTGTTTTGGATCATCAAAATAATGAAGGTGCATCATGTGACTGGAAAAAGCCCTTTCCA
AAGATCCCTGAAGTTCCCCTCCATGATACCCCAGAGAGGAGTGCAGCAGATAACAAGGAC
CTGATCTTAGATCCATGCTGTCAGCTTCCAGCCTACCTGTCTACCTGCCCTGGCCAGAGC
AGCAGCTTGGCAGTAACCAAAACAAATTCTGACATCCTTCCACCCCAGAAGAAAACCAAG
CCGAGTCAGAAGGTCCAGGGAAGAGGCTCACACGGATGCCAGCAGCAGAGACAAGCAAGG
CAGAAGGAAAGCACCCTGAGAAGACAGGAAAGAAAGAATGCAGCACTGGTTACCAGGATG
AAAGCCCAGAGGCCAGAGGAATGCTTAAAACACATCATTGTAGTGCTGGATCCAGTGCTC
TTACAGATGGAAGGTGGGGGCCAGCTCCTAGGAGCACTGCAGACCATGGAGTGCCGCTGT
GTGATTGAGGCGCAGGCTGTGCCTTGCAGTGTCACTTGGAGGAGAAGGGCTGGGCCGTCT
GAGGACAGAGAGGACTGGGTGGAGGAGCCAACAGTACTGGTGTTGCTCCGGGCAGAGGCA
TTTGTGTCCATGATCGACAATGGAAAGCAGGGAAGCCTGGACAGCACTATGAAAGGGAAG
GAAACGCTTCAGGGCTTTGTAACTGACATCACAGCAAAGACAGCAGGGAAAGCTCTGTCA
CTGGTGATTGTGGATCAGGAGAAATGCTTCAGTGCTCAGAATCCTCCAAGAAGAGGGAAA
CAGGGAGCAAATAAACAGACCAAGAAGCAGCAGCAGAGACAACCAGAGGCCAGCATAGGG
TCCATGGTATCCAGGGTAGACGCTGAAGAGGCATTGGTGGATCTGCAGCTACACACAGAA
GCCCAGGCTCAAATTGTGCAGAGCTGGAAAGAGCTGGCCGACTTCACATGCGCATTCACA
AAGGCTGTGGCTGAGGCGCCCTTCAAGAAGCTCCGAGATGAAACTACCTTCTCCTTCTGT
CTGGAGAGTGACTGGGCTGGAGGGGTGAAGGTGGACCTTGCTGGCAGGGGACTCGCACTA
GTCTGGAGGAGACAGATTCAGCAGCTGAACCGAGTCAGCCTGGAAATGGCCAGTGCAGTT
GTGAATGCCTATCCCTCCCCACAGCTCCTGGTACAGGCTTATCAGCAGTGTTTTTCGGAT
AAAGAACGCCAGAATTTGCTCGCAGACATACAGGTGCGCCGTGGGGAAGGTGTGACATCC
ACTTCTCGCCGCATTGGACCAGAACTATCCAGGCGTATCTACCTTCAGATGACCACTTTA
CAGCCACATCTCTCTTTAGATAGTGCTGACTGA
Protein Properties
Number of Residues 570
Molecular Weight 63251.3
Theoretical pI 7.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Crossover junction endonuclease EME1
MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAP
ELFSPPVPEIAETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVK
SVLDHQNNEGASCDWKKPFPKIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQS
SSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALVTRM
KAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPS
EDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALS
LVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTE
AQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLAL
VWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTS
TSRRIGPELSRRIYLQMTTLQPHLSLDSAD
GenBank ID Protein 16550776
UniProtKB/Swiss-Prot ID Q96AY2
UniProtKB/Swiss-Prot Entry Name EME1_HUMAN
PDB IDs Not Available
GenBank Gene ID AK055926
GeneCard ID EME1
GenAtlas ID EME1
HGNC ID HGNC:24965
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Ogrunc M, Sancar A: Identification and characterization of human MUS81-MMS4 structure-specific endonuclease. J Biol Chem. 2003 Jun 13;278(24):21715-20. Epub 2003 Apr 9. [PubMed:12686547 ]
  10. Ciccia A, Constantinou A, West SC: Identification and characterization of the human mus81-eme1 endonuclease. J Biol Chem. 2003 Jul 4;278(27):25172-8. Epub 2003 Apr 29. [PubMed:12721304 ]
  11. Blais V, Gao H, Elwell CA, Boddy MN, Gaillard PH, Russell P, McGowan CH: RNA interference inhibition of Mus81 reduces mitotic recombination in human cells. Mol Biol Cell. 2004 Feb;15(2):552-62. Epub 2003 Nov 14. [PubMed:14617801 ]
  12. Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC: Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM. Mol Cell. 2007 Feb 9;25(3):331-43. [PubMed:17289582 ]