You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08725
Secondary Accession Numbers
  • 14448
Name Forkhead box protein K2
Synonyms
  1. Cellular transcription factor ILF-1
  2. FOXK1
  3. Interleukin enhancer-binding factor 1
Gene Name FOXK2
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Recognizes the core sequence 5'-TAAACA-3'. Binds to NFAT-like motifs (purine-rich) in the IL2 promoter. Also binds to HIV-1 long terminal repeat. May be involved in both positive and negative regulation of important viral and cellular promoter elements
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
nucleic acid binding
dna binding
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25
SNPs FOXK2
Gene Sequence
>1983 bp
ATGGCGGCGGCCGCGGCGGCGCTCTCGGGCGCGGGCACGCCACCCGCGGGCGGCGGGGCC
GGGGGCGGCGGGGCCGGGGGCGGCGGGTCCCCGCCGGGCGGCTGGGCCGTGGCGCGCCTG
GAGGGCCGCGAGTTCGAGTATCTGATGAAGAAGCGCTCGGTGACCATCGGCCGCAACTCG
TCGCAGGGCTCGGTGGACGTGAGCATGGGCCACTCGAGCTTCATCTCCCGGCGCCACCTC
GAGATCTTCACGCCCCCGGGCGGCGGCGGCCATGGCGGGGCCGCTCCGGAGCTGCCGCCC
GCGCAGCCCAGGCCCGACGCCGGCGGCGACTTCTACCTGCGCTGCTTGGGCAAGAACGGG
GTATTCGTGGACGGCGTGTTCCAGAGGCGCGGGGCGCCGCCGCTGCAGCTGCCGCGCGTG
TGCACATTCAGGTTCCCGAGCACAAACATCAAGATAACGTTCACTGCCCTGTCCAGCGAG
AAGAGAGAGAAGCAGGAGGCGTCTGAGTCTCCAGTGAAGGCCGTACAGCCACACATCTCG
CCCCTGACCATCAACATTCCAGACACCATGGCCCACCTCATCAGCCCTCTGCCCTCCCCC
ACGGGAACCATCAGCGCTGCAAACTCCTGCCCCTCCAGCCCCCGGGGAGCGGGGTCTTCA
GGGTACAAGGTGGGCCGAGTGATGCCATCTGACCTCAATTTAATGGCTGACAACTCACAG
CCTGAAAATGAAAAGGAAGCTTCAGGTGGAGACAGCCCGAAGGATGATTCAAAGCCGCCT
TACTCCTACGCGCAGCTGATAGTTCAGGCGATTACGATGGCTCCCGACAAACAGCTCACC
CTGAACGGGATTTATACACACATCACTAAAAATTATCCCTACTACAGGACTGCGGACAAG
GGCTGGCAGAATTCAATTCGCCACAATCTCTCTCTGAATCGTTATTTCATCAAAGTGCCG
CGTTCCCAGGAAGAACCAGGCAAAGGCTCGTTCTGGAGGATAGACCCAGCCTCTGAAAGC
AAATTAATAGAACAGGCTTTTAGGAAACGACGGCCTAGGGGCGTGCCCTGCTTTAGAACC
CCTCTGGGACCGCTCTCTTCTAGGAGTGCCCCAGCCTCTCCCAATCACGCGGGAGTGCTG
TCTGCTCACTCTAGTGGCGCCCAGACCCCTGAGAGCCTGTCGAGGGAAGGTTCGCCGGCC
CCCCTGGAGCCTGAGCCTGGCGCTGCACAGCCCAAACTCGCTGTCATCCAGGAAGCCCGG
TTTGCCCAGAGCGCCCCAGGGTCACCTCTGTCCAGTCAGCCAGTCTTAATCACCGTCCAG
CGGCAGCTACCACAGGCCATCAAGCCTGTCACCTACACTGTGGCCACCCCAGTGACCACC
TCGACCTCCCAGCCACCCGTCGTGCAGACGGTTCACGTCGTCCACCAGATCCCAGCGGTG
TCGGTCACCAGTGTGGCCGGACTGGCCCCAGCGAACACGTACACTGTCTCTGGACAAGCT
GTGGTCACCCCGGCAGCCGTGCTGGCCCCTCCTAAGGCAGAGGCCCAGGAGAATGGAGAC
CACAGGGAAGTCAAAGTGAAAGTAGAGCCTATTCCCGCCATTGGCCACGCCACGCTCGGC
ACTGCCAGCCGGATCATTCAGACGGCACAGACCACCCCGGTCCAGACGGTGACCATAGTA
CAACAGGCACCTCTAGGTCAACACCAGCTACCAATAAAAACTGTAACACAAAACGGCACT
CACGTGGCATCAGTCCCCACTGCGGTCCACGGCCAGGTGAACAATGCCGCGGCGAGTCCT
TTGCACATGTTGGCAACACACGCATCCGCATCGGCCTCCCTGCCCACAAAGCGCCACAAC
GGTGACCAGCCGGAGCAGCCGGAGCTGAAGCGGATCAAGACAGAAGACGGCGAGGGCATC
GTCATTGCCCTGAGCGTGGACACGCCACCGGCAGCCGTAAGGGAAAAGGGTGTCCAGAAC
TAG
Protein Properties
Number of Residues 660
Molecular Weight 69061.5
Theoretical pI 10.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Forkhead box protein K2
MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNS
SQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNG
VFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHIS
PLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQ
PENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADK
GWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRT
PLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEAR
FAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAV
SVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
TASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASP
LHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
GenBank ID Protein 31563338
UniProtKB/Swiss-Prot ID Q01167
UniProtKB/Swiss-Prot Entry Name FOXK2_HUMAN
PDB IDs
GenBank Gene ID NM_004514.3
GeneCard ID FOXK2
GenAtlas ID FOXK2
HGNC ID HGNC:6036
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  6. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Li C, Lai CF, Sigman DS, Gaynor RB: Cloning of a cellular factor, interleukin binding factor, that binds to NFAT-like motifs in the human immunodeficiency virus long terminal repeat. Proc Natl Acad Sci U S A. 1991 Sep 1;88(17):7739-43. [PubMed:1909027 ]
  9. Li C, Lusis AJ, Sparkes R, Nirula A, Gaynor R: Characterization and chromosomal mapping of the gene encoding the cellular DNA binding protein ILF. Genomics. 1992 Jul;13(3):665-71. [PubMed:1339390 ]
  10. Liu PP, Chen YC, Li C, Hsieh YH, Chen SW, Chen SH, Jeng WY, Chuang WJ: Solution structure of the DNA-binding domain of interleukin enhancer binding factor 1 (FOXK1a). Proteins. 2002 Dec 1;49(4):543-53. [PubMed:12402362 ]
  11. Tsai KL, Huang CY, Chang CH, Sun YJ, Chuang WJ, Hsiao CD: Crystal structure of the human FOXK1a-DNA complex and its implications on the diverse binding specificity of winged helix/forkhead proteins. J Biol Chem. 2006 Jun 23;281(25):17400-9. Epub 2006 Apr 18. [PubMed:16624804 ]