You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08732
Secondary Accession Numbers
  • 14455
Name Inositol monophosphatase 3
Synonyms
  1. IMP 3
  2. IMPase 3
  3. Inositol monophosphatase domain-containing protein 1
  4. Inositol-1(or 4)-monophosphatase 3
  5. Myo-inositol monophosphatase A3
  6. Golgi 3-prime phosphoadenosine 5-prime phosphate 3-prime phosphatase
  7. Golgi-resident PAP phosphatase
  8. gPAPP
Gene Name IMPAD1
Protein Type Unknown
Biological Properties
General Function Involved in inositol or phosphatidylinositol phosphatase activity
Specific Function May play a role in the formation of skeletal elements derived through endochondral ossification, possibly by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation (By similarity).
Pathways
  • Inositol phosphate metabolism
  • myo-inositol biosynthesis
  • Phosphatidylinositol signaling system
  • sulfur metabolism
Reactions
Myo-inositol phosphate + Water → myo-Inositol + Phosphoric acid details
Adenosine 3',5'-diphosphate + Water → Adenosine monophosphate + Phosphoric acid details
Phosphoadenosine phosphosulfate + Water → Adenosine phosphosulfate + Phosphoric acid details
Inositol phosphate + Water → myo-Inositol + Phosphoric acid details
D-Myo-inositol 4-phosphate + Water → myo-Inositol + Phosphoric acid details
Myo-inositol 1-phosphate + Water → myo-Inositol + Phosphoric acid details
GO Classification
Biological Process
inositol biosynthetic process
phosphatidylinositol phosphorylation
chondrocyte development
embryonic digit morphogenesis
post-embryonic development
chondroitin sulfate metabolic process
endochondral ossification
Cellular Component
Golgi apparatus
integral to membrane
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
Molecular Function
metal ion binding
inositol monophosphate 1-phosphatase activity
inositol monophosphate 3-phosphatase activity
inositol monophosphate 4-phosphatase activity
3'-nucleotidase activity
3'(2'),5'-bisphosphate nucleotidase activity
Cellular Location
  1. Membrane
  2. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location 8
Locus 8q12.1
SNPs IMPAD1
Gene Sequence
>1080 bp
ATGGCCCCCATGGGCATCCGCCTTTCCCCACTGGGGGTGGCAGTGTTTTGTCTGCTGGGG
CTCGGCGTGCTCTACCACCTCTACTCGGGCTTCTTGGCCGGCCGCTTCAGCCTCTTCGGC
CTGGGCGGCGAGCCTGGCGGCGGCGCGGCGGGGCCCGCGGCCGCGGCCGATGGGGGCACC
GTGGACTTGCGCGAGATGCTGGCTGTGTCAGTGCTGGCCGCAGTCCGCGGCGGCGACGAG
GTGAGGCGCGTCCGCGAGAGCAACGTCCTCCACGAGAAGTCCAAGGGGAAGACGCGCGAG
GGAGCCGAGGACAAGATGACCAGCGGCGACGTGCTGTCCAACCGCAAGATGTTCTACCTG
CTCAAGACCGCCTTCCCCAGCGTCCAGATTAATACTGAGGAACACGTGGATGCAGCTGAT
CAGGAGGTTATCTTGTGGGATCATAAGATTCCTGAGGATATCCTAAAGGAAGTAACTACT
CCTAAAGAGGTACCAGCAGAAAGTGTTACTGTCTGGATTGACCCACTTGATGCTACACAG
GAATATACAGAGGATCTTCGAAAGTACGTCACTACTATGGTGTGTGTGGCTGTAAATGGT
AAACCCATGCTAGGAGTTATACATAAGCCATTTTCCGAATATACAGCTTGGGCAATGGTA
GATGGTGGTTCAAATGTGAAAGCCCGCTCTTCCTACAATGAGAAGACCCCAAGGATCGTT
GTGTCTCGTTCCCATTCAGGGATGGTCAAACAGGTCGCTCTTCAGACTTTTGGAAACCAG
ACTACAATTATCCCAGCTGGTGGTGCTGGTTATAAAGTTTTAGCACTTTTGGATGTGCCT
GATAAGAGTCAAGAAAAAGCTGATTTATACATCCATGTGACATACATCAAAAAGTGGGAT
ATATGTGCTGGTAATGCCATCTTAAAAGCCCTAGGGGGGCATATGACTACCCTGAGTGGT
GAAGAAATCAGTTACACTGGTTCAGACGGCATTGAAGGGGGACTCCTTGCTAGCATCAGA
ATGAACCACCAGGCCCTGGTCAGAAAACTCCCAGATCTAGAAAAGACAGGACATAAATGA
Protein Properties
Number of Residues 359
Molecular Weight 38681.15
Theoretical pI 6.864
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol monophosphatase 3
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
GenBank ID Protein 7020510
UniProtKB/Swiss-Prot ID Q9NX62
UniProtKB/Swiss-Prot Entry Name IMPA3_HUMAN
PDB IDs Not Available
GenBank Gene ID AK000428
GeneCard ID IMPAD1
GenAtlas ID IMPAD1
HGNC ID HGNC:26019
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]