You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08787
Secondary Accession Numbers
  • 14510
Name Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial
Synonyms
  1. PDPr
Gene Name PDPR
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Decreases the sensitivity of PDP1 to magnesium ions, and this inhibition is reversed by the polyamine spermine
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
aminomethyltransferase activity
oxidoreductase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
metabolic process
cellular metabolic process
serine family amino acid metabolic process
glycine metabolic process
glycine catabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs PDPR
Gene Sequence
>2640 bp
ATGATGTTCTACCGGTTGCTGTCGATTGTTGGAAGACAAAGAGCCAGCCCAGGATGGCAG
AACTGGTCCTCTGCAAGAAACAGCACGTCAGCTGCCGAGGCGCGTTCCATGGCCCTGCCC
ACCCAGGCACAGGTGGTCATCTGTGGAGGTGGAATCACGGGCACTTCTGTGGCCTATCAC
CTCTCCAAAATGGGGTGGAAGGATATTGTCCTTTTGGAGCAGGGCAGGCTGGCTGCTGGC
TCTACCAGGTTCTGTGCTGGCATCCTGAGCACTGCCAGGCACTTGACCATTGAGCAGAAG
ATGGCAGACTACTCAAACAAACTCTACTATCAGTTAGAGCAAGAAACAGGGATCCAAACA
GGTTACACAAGGACAGGCTCAATCTTTCTGGCCCAAACTCAGGACCGACTGATCTCCCTG
AAGCGCATCAACGCAGGGCTGAATGTTATAGGTATCCCTTCTGAGATCATCTCCCCCAAG
AAAGTGGCCGAGCTTCACCATCTCCTCAACGTGCACGACCTGGTGGGGGCCATGCATGTT
CCCGAGGATGCAGTGGTGTCTTCCGCTGACGTGGCTCTTGCCCTGGCAAGTGCTGCCTCC
CAAAATGGTGTTCAGATCTATGACCGGACATCTGTTCTTCATGTAATGGTCAAAAAAGGT
CAAGTTACTGGAGTGGAGACCGATAAAGGACAGATTGAATGCCAGTATTTTGTCAACTGT
GCTGGCCAGTGGGCATACGAGCTGGGTCTGTCCAACGAGGAGCCGGTTAGTATCCCGCTA
CATGCCTGCGAACACTTCTACCTCCTGACTCGCCCCTTGGAGACCCCTCTGCAGAGCAGC
ACACCAACTATTGTGGATGCTGATGGAAGAATTTATATTCGGAACTGGCAGGGTGGCATC
CTGTCTGGGGGCTTTGAGAAGAACCCGAAACCAATTTTCACTGAGGGCAAGAACCAGCTG
GAGATTCAGAATCTACAGGAAGACTGGGATCACTTTGAGCCTCTGTTGAGTTCCCTTCTG
AGGAGGATGCCAGAATTAGAGACTCTGGAGATCATGAAGTTGGTGAACTGCCCAGAGACC
TTCACACCAGACATGAGGTGCATCATGGGCGAGTCTCCTGCAGTGCAGGGCTACTTTGTC
CTGGCAGGAATGAACTCTGCTGGCCTTTCATTTGGTGGAGGAGCCGGAAAGTACCTTGCC
GAATGGATGGTACATGGTTATCCCTCAGAAAACGTTTGGGAATTGGACCTGAAACGTTTT
GGAGCCCTCCAGAGCAGCCGCACCTTTCTGCGCCACCGGGTCATGGAAGTCATGCCTTTG
ATGTATGATCTGAAGGTTCCCCGCTGGGACTTCCAGACCGGTAGGCAGTTACGCACCTCT
CCTCTCTACGACCGGCTGGATGCACAGGGAGCCAGGTGGATGGAGAAACATGGATTTGAG
AGGCCAAAGTACTTTGTTCCCCCCGACAAGGACCTCCTGGCATTGGAGCAGAGCAAGACT
TTCTATAAGCCAGATTGGTTTGACATCGTGGAGTCTGAAGTCAAGTGCTGTAAGGAAGCT
GTGTGTGTCATTGACATGTCCTCTTTCACAAAGTTTGAGATAACATCCACTGGGGATCAG
GCATTAGAAGTTCTACAGTACCTCTTCTCCAATGACCTGGATGTGCCTGTGGGCCACATT
GTGCATACTGGCATGCTCAACGAGGGTGGAGGGTATGAAAATGACTGCAGCATAGCACGA
CTGAACAAGCGCAGTTTCTTCATGATCTCTCCAACCGACCAGCAGGTCCACTGTTGGGCC
TGGCTTAAGAAACACATGCCGAAAGACAGCAACCTGCTCCTGGAGGACGTCACCTGGAAG
TACACAGCCCTCAATCTGATTGGCCCTCGAGCTGTGGATGTGCTGTCTGAGTTGTCCTAT
GCCCCTATGACTCCAGACCACTTCCCAAGCCTCTTTTGCAAGGAGATGAGTGTGGGCTAT
GCAAATGGGATCCGGGTGATGAGCATGACGCACACAGGAGAGCCAGGATTCATGCTCTAC
ATCCCCATAGAGTACGCCCTGCATGTATACAATGAAGTGATGAGTGTTGGCCAGAAATAC
GGAATCCGGAATGCTGGGTATTACGCTCTTCGCAGTCTCCGAATTGAGAAGTTTTTTGCC
TTCTGGGGTCAGGATATAAATAACCTCACCACGCCCCTGGAATGTGGACGAGAGTCTCGG
GTGAAATTAGAGAAGGGCATGGATTTCATTGGTCGCGACGCCCTCCTGCAGCAGAAGCAG
AATGGAGTGTATAAACGCCTCACCATGTTCATCCTGGACGACCATGATTCAGACCTAGAC
CTTTGGCCTTGGTGGGGAGAGCCCATTTACCGGAATGGGCAGTATGTTGGCAAGACCACC
AGCAGTGCCTACAGCTACAGCCTGGAGCGCCACGTTTGCCTGGGCTTTGTGCACAATTTT
TCTGAGGACACGGGGGAAGAGCAAGTGGTGACAGCAGATTTCATCAACCGGGGAGAGTAT
GAGATTGACATCGCGGGATACCGCTTCCAGGCCAAGGCCAAGCTCTACCCTGTCGCCTCC
CTCTTCACCCAGAAGCGCCGAAAGGATGACATGGAGCTGAGTGACTTACATGGGAAGTGA
Protein Properties
Number of Residues 879
Molecular Weight 99363.7
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial
MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQ
ALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWA
WLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGY
ANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFA
FWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDSDLD
LWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEY
EIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK
GenBank ID Protein 194306651
UniProtKB/Swiss-Prot ID Q8NCN5
UniProtKB/Swiss-Prot Entry Name PDPR_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017990.3
GeneCard ID PDPR
GenAtlas ID PDPR
HGNC ID HGNC:55066
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Ohara O, Nagase T, Mitsui G, Kohga H, Kikuno R, Hiraoka S, Takahashi Y, Kitajima S, Saga Y, Koseki H: Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method. DNA Res. 2002 Apr 30;9(2):47-57. [PubMed:12056414 ]