Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08825
Secondary Accession Numbers
  • 14550
Name Titin
Synonyms
  1. Connectin
  2. Rhabdomyosarcoma antigen MU-RMS-40.14
Gene Name TTN
Protein Type Unknown
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
protein tyrosine kinase activity
binding
ras guanyl-nucleotide exchange factor activity
catalytic activity
rho guanyl-nucleotide exchange factor activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
regulation of ras protein signal transduction
metabolic process
regulation of rho protein signal transduction
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
protein amino acid phosphorylation
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm (Probable)
Gene Properties
Chromosome Location Chromosome:2
Locus 2q31
SNPs TTN
Gene Sequence
>103053 bp
ATGACAACTCAAGCACCGACGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGT
AGTACCGCAACCTTTGAGGCTCACATTAGTGGTTTTCCAGTTCCTGAGGTGAGCTGGTTT
AGGGATGGCCAGGTGATTTCCACTTCCACTCTGCCCGGCGTGCAGATCTCCTTTAGCGAT
GGCCGCGCTAAACTGACGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATATTCCCTG
AAAGCCACCAATGGATCTGGACAAGCGACTAGTACTGCTGAGCTTCTCGTGAAAGCTGAG
ACAGCACCACCCAACTTCGTTCAACGACTGCAGAGCATGACCGTGAGACAAGGAAGCCAA
GTGAGACTCCAAGTGAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGAT
GGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCACAAGAAGGCGACCTCTACAGC
TTACTGATTGCAGAAGCATACCCTGAGGACTCAGGGACCTATTCAGTAAATGCCACCAAT
AGCGTTGGAAGAGCTACTTCGACTGCTGAATTACTGGTTCAAGGTGAAGAAGAAGTACCT
GCTAAAAAGACAAAGACAATTGTTTCGACTGCTCAGATCTCAGAATCAAGACAAACCCGA
ATTGAAAAGAAGATTGAAGCCCACTTTGATGCCAGATCAATTGCAACAGTTGAGATGGTC
ATAGATGGTGCCGCTGGGCAACAGCTGCCACATAAAACACCTCACAGGATTCCTCCGAAG
CCAAAGTCAAGATCCCCAACACCACCGTCTATTGCTGCCAAAGCACAGCTGGCTCGGCAG
CAGTCCCCATCGCCCATAAGACACTCCCCTTCCCCGGTCAGACACGTGCGGGCACCGACC
CCATCTCCGGTCAGGTCCGTGTCTCCAGCAGCAAGAATCTCCACATCCCCCATCAGGTCT
GTTAGGTCTCCATTGCTCATGCGTAAGACTCAGGCATCCACCGTGGCCACAGGTCCTGAA
GTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCATCTGAGGCTGAGATGAGA
GAGACAACGCTGACAACCTCTACTCAGATCAGGACAGAAGAGAGATGGGAAGGGAGATAC
GGTGTCCAGGAGCAAGTGACCATCAGTGGTGCTGCGGGTGCTGCCGCCAGTGTGTCGGCC
AGTGCTAGCTACGCAGCAGAGGCTGTTGCCACTGGTGCTAAAGAGGTGAAACAAGATGCT
GACAAAAGTGCAGCTGTTGCGACTGTTGTTGCTGCCGTTGATATGGCCAGAGTGAGAGAA
CCAGTGATCAGCGCTGTAGAGCAGACTGCTCAGAGGACAACCACGACTGCTGTGCACATC
CAACCTGCTCAAGAACAGGTAAGAAAGGAAGCGGAGAAGACTGCTGTAACTAAGGTAGTA
GTGGCCGCCGATAAAGCCAAGGAACAAGAATTAAAATCAAGAACCAAAGAAGTAATTACC
ACAAAGCAAGAGCAGATGCACGTAACTCATGAGCAGATAAGAAAAGAAACTGAAAAAACA
TTTGTACCAAAGGTAGTAATTTCCGCAGCTAAAGCCAAAGAACAAGAAACTAGAATTTCT
GAAGAAATTACTAAGAAACAGAAACAAGTAACTCAAGAAGCAATAAGACAGGAAACTGAG
ATAACTGCTGCATCCATGGTGGTAGTTGCCACTGCAAAGTCCACAAAACTAGAAACAGTC
CCGGGAGCTCAAGAAGAAACTACCACACAACAAGATCAAATGCACCTAAGTTATGAAAAG
ATAATGAAGGAAACTAGGAAAACAGTTGTACCTAAAGTCATAGTTGCCACACCCAAAGTC
AAAGAACAAGATTTAGTATCAAGAGGTAGAGAAGGCATTACTACCAAAAGAGAACAAGTG
CAAATAACTCAGGAGAAGATGAGAAAGGAAGCCGAGAAAACTGCCTTGTCTACAATAGCA
GTTGCTACTGCTAAAGCCAAAGAACAAGAAACAATACTGAGAACTAGAGAAACTATGGCT
ACTAGACAAGAACAAATCCAAGTTACCCATGGAAAGGTGGACGTTGGAAAAAAGGCTGAA
GCTGTAGCAACAGTTGTTGCTGCAGTAGACCAGGCCCGAGTCAGAGAGCCCAGAGAGCCT
GGGCATCTTGAAGAATCCTATGCTCAGCAGACCACTTTGGAGTACGGATATAAGGAACGC
ATTTCCGCCGCAAAGGTAGCTGAGCCTCCCCAACGTCCAGCCTCAGAACCCCACGTTGTC
CCTAAAGCAGTCAAGCCTAGAGTAATCCAGGCTCCTTCTGAGACTCATATCAAAACTACT
GATCAAAAGGGAATGCACATATCATCACAGATCAAGAAAACTACAGATCTAACAACGGAA
AGATTAGTCCATGTGGATAAACGCCCCCGCACAGCTAGCCCTCACTTTACTGTTTCAAAA
ATTTCTGTTCCTAAGACAGAACATGGATATGAGGCATCAATAGCCGGTAGTGCTATTGCC
ACATTACAAAAAGAGTTGTCAGCCACATCTTCTGCTCAGAAGATCACCAAATCGGTGAAG
GCTCCTACTGTGAAGCCCAGTGAGACTAGAGTAAGGGCAGAGCCCACACCCTTGCCACAG
TTCCCCTTCGCTGACACACCAGATACTTACAAGAGTGAAGCTGGCGTTGAGGTGAAAAAG
GAAGTAGGGGTGAGCATCACTGGCACCACCGTCCGTGAAGAGCGCTTTGAAGTACTGCAC
GGACGCGAAGCCAAGGTAACAGAAACAGCAAGAGTACCAGCACCTGTTGAAATTCCTGTT
ACTCCACCAACTTTGGTCTCGGGCTTAAAAAATGTGACTGTCATAGAAGGTGAATCTGTC
ACCTTGGAGTGCCACATCTCTGGATACCCATCCCCGACAGTGACATGGTACAGGGAAGAC
TACCAAATCGAAAGTTCCATTGACTTCCAGATAACCTTCCAGAGTGGAATTGCTCGTCTT
ATGATTCGCGAAGCATTTGCGGAAGACAGCGGGCGATTTACTTGCAGTGCTGTAAATGAG
GCTGGAACCGTCAGCACATCCTGCTACCTGGCTGTGCAGGTGTCAGAAGAATTTGAAAAG
GAAACCACAGCCGTGACTGAGAAATTTACTACAGAAGAGAAACGCTTTGTTGAGTCAAGA
GATGTGGTTATGACTGATACTAGCCTCACAGAGGAACAAGCAGGGCCTGGAGAACCTGCC
GCGCCTTACTTTATTACAAAACCAGTGGTCCAGAAACTGGTGGAAGGTGGGAGCGTGGTG
TTTGGATGCCAAGTTGGCGGCAACCCAAAGCCCCATGTATACTGGAAAAAATCTGGTGTT
CCTCTAACCACTGGATACAGATACAAAGTGAGTTACAACAAACAAACCGGTGAATGCAAG
CTGGTGATTTCTATGACTTTTGCTGATGATGCTGGAGAATACACTATTGTTGTTCGCAAT
AAGCATGGAGAAACTTCTGCATCTGCTTCCTTGCTTGAAGAAGCTGATTATGAGTTACTG
ATGAAGTCCCAGCAAGAAATGCTTTATCAGACACAAGTGACTGCATTTGTTCAAGAACCT
AAAGTTGGAGAAACAGCACCTGGATTTGTATACTCTGAGTATGAAAAAGAGTATGAAAAA
GAACAAGCCTTAATTAGGAAGAAAATGGCCAAAGATACTGTAGTGGTCAGAACTTATGTA
GAAGATCAGGAATTCCATATTTCTTCCTTTGAAGAGAGGCTTATTAAAGAAATTGAATAT
AGAATAATAAAGACTACATTAGAAGAACTTCTTGAAGAAGATGGAGAAGAAAAGATGGCA
GTTGACATTTCTGAATCTGAAGCTGTTGAATCAGGATTTGATTTAAGAATCAAGAATTAT
AGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGATGTCTGGATATCCATTACCA
AAGATTGCTTGGTACAAAGATGGCAAGCGCATCAAACATGGAGAAAGATACCAAATGGAC
TTTCTACAAGATGGCAGAGCTAGTCTGCGTATACCTGTTGTTCTTCCAGAAGATGAAGGA
ATCTACACTGCATTTGCCAGCAATATTAAAGGAAATGCAATTTGCTCAGGGAAATTGTAT
GTGGAGCCTGCTGCACCACTTGGAGCTCCGACTTACATTCCCACACTAGAGCCAGTGAGC
AGAATCAGATCTCTCTCTCCACGTTCAGTGAGCAGGTCTCCTATACGCATGTCTCCTGCA
CGGATGTCACCTGCAAGGATGTCTCCTGCACGGATGTCCCCTGCAAGAATGTCCCCTGGA
CGTAGGCTGGAGGAGACAGATGAGTCACAACTTGAGAGACTATATAAACCAGTCTTTGTG
TTAAAACCTGTTTCTTTCAAATGTTTAGAAGGGCAAACTGCCAGATTTGACTTAAAGGTT
GTTGGTAGACCTATGCCAGAGACGTTCTGGTTTCATGATGGCCAGCAAATTGTCAATGAC
TATACCCATAAAGTAGTCATTAAAGAAGATGGTACTCAATCACTAATTATTGTCCCTGCC
ACACCCAGTGATTCTGGGGAATGGACTGTGGTTGCCCAAAACAGGGCAGGCAGATCTTCA
ATTTCAGTGATTTTAACTGTGGAAGCTGTGGAACATCAGGTAAAACCGATGTTTGTAGAA
AAACTGAAAAATGTCAATATAAAGGAAGGTTCCCAACTTGAAATGAAAGTCAGAGCTACG
GGTAACCCCAACCCTGACATTGTATGGTTGAAAAACAGTGACATCATTGTGCCTCATAAA
TATCCCAAAATCAGAATTGAAGGAACCAAGGGAGAAGCTGCCCTTAAAATCGATTCCACT
GTCAGCCAAGATTCTGCCTGGTATACTGCGACTGCTATTAATAAAGCTGGCAGAGACACT
ACAAGATGCAAAGTAAATGTTGAAGTTGAGTTTGCAGAGCCTGAGCCAGAGAGAAAGTTA
ATCATCCCACGGGGGACATATAGAGCAAAGGAGATTGCAGCCCCAGAACTGGAGCCCCTC
CATTTGCGATATGGCCAAGAGCAATGGGAAGAAGGTGATCTCTATGACAAAGAGAAACAA
CAGAAACCATTTTTCAAGAAAAAACTCACTTCCTTAAGACTTAAGCGCTTTGGGCCTGCC
CACTTTGAATGCAGGCTAACACCCATTGGTGACCCAACGATGGTGGTGGAGTGGCTCCAT
GATGGAAAGCCACTTGAAGCAGCCAACAGGCTCCGTATGATCAATGAATTTGGGTACTGC
AGCCTTGATTATGGCGTTGCATATTCTAGAGACAGTGGTATCATTACTTGCAGAGCCACT
AACAAATATGGAACAGATCACACATCTGCTACCCTTATTGTTAAAGATGAGAAAAGTCTT
GTGGAAGAATCCCAATTGCCTGAGGGGAGGAAAGGCTTACAGAGAATTGAAGAATTAGAG
AGAATGGCTCATGAAGGTGCACTTACAGGTGTAACAACAGATCAGAAAGAAAAGCAAAAG
CCAGACATTGTCTTGTACCCAGAGCCAGTTAGAGTACTTGAAGGGGAGACTGCAAGGTTC
CGCTGCAGGGTAACAGGCTACCCTCAGCCCAAAGTCAACTGGTACCTCAATGGACAGCTC
ATCCGCAAAAGCAAAAGGTTCAGAGTTCGCTATGATGGTATCCATTACCTGGACATCGTG
GACTGCAAATCATATGACACAGGTGAAGTGAAGGTCACCGCGGAAAATCCTGAAGGTGTG
ATAGAGCATAAAGTGAAGCTTGAGATTCAACAGAGGGAAGATTTTAGGTCTGTCCTTAGG
AGAGCTCCTGAACCAAGGCCTGAGTTTCACGTACATGAACCAGGAAAGCTTCAGTTTGAA
GTACAAAAAGTGGATAGACCTGTTGACACCACTGAAACCAAAGAAGTTGTGAAGTTGAAA
AGGGCTGAAAGAATTACCCATGAAAAAGTGCCTGAAGAGTCGGAAGAGCTGCGCAGTAAA
TTCAAGCGCAGAACAGAAGAGGGCTATTATGAAGCCATTACCGCTGTGGAGCTCAAGTCT
CGAAAGAAGGATGAATCCTATGAGGAACTCCTCAGGAAGACAAAAGATGAACTTCTCCAC
TGGACCAAAGAGTTAACTGAAGAGGAAAAGAAAGCTCTTGCCGAAGAAGGCAAAATCACG
ATTCCAACTTTTAAACCTGACAAGATTGAACTAAGTCCTAGTATGGAGGCTCCAAAAATC
TTCGAAAGAATCCAGAGCCAAACAGTGGGCCAAGGATCTGATGCACACTTCCGGGTCAGA
GTCGTGGGGAAACCAGACCCCGAATGTGAATGGTACAAAAATGGTGTCAAAATTGAACGG
TCTGACCGGATCTACTGGTACTGGCCCGAAGACAATGTTTGTGAATTGGTCATAAGAGAT
GTGACTGCTGAGGACTCTGCCAGCATCATGGTAAAAGCCATCAACATAGCTGGAGAAACC
TCCAGTCACGCATTCTTACTTGTCCAAGCCAAGCAATTGATCACTTTCACACAGGAATTA
CAAGATGTTGTTGCTAAGGAAAAAGACACTATGGCAACCTTTGAATGTGAAACTTCAGAA
CCATTTGTCAAAGTGAAATGGTATAAAGATGGTATGGAGGTTCATGAGGGAGATAAATAC
AGGATGCACTCTGACAGAAAGGTTCACTTCCTCTCCATACTGACCATTGATACGTCTGAT
GCTGAAGATTACAGCTGTGTACTTGTGGAAGATGAAAATGTCAAAACGACTGCTAAACTT
ATTGTTGAAGGTGCAGTTGTTGAGTTTGTGAAAGAACTTCAGGACATAGAAGTTCCAGAA
TCATATTCAGGAGAATTAGAGTGCATTGTATCCCCAGAAAATATAGAAGGAAAATGGTAT
CATAATGATGTGGAGCTTAAATCCAATGGCAAATATACAATTACATCTCGTCGTGGACGT
CAGAACCTCACGGTCAAGGATGTAACCAAGGAGGACCAGGGAGAATACAGCTTTGTCATC
GACGGGAAAAAGACAACCTGTAAATTAAAGATGAAACCCCGCCCCATTGCTATCCTACAA
GGACTTAGTGACCAAAAAGTCTGTGAGGGTGACATTGTTCAGCTTGAAGTTAAAGTCTCC
TTGGAAAGTGTGGAAGGCGTCTGGATGAAAGACGGCCAAGAAGTGCAGCCCAGTGACAGG
GTTCACATTGTGATAGACAAACAATCTCATATGCTGCTCATTGAAGACATGACTAAGGAA
GATGCTGGAAATTACTCTTTCACCATTCCAGCCCTTGGCCTCTCCACCAGTGGGCGTGTC
TCTGTCTATAGTGTGGACGTGATAACACCTCTAAAAGATGTTAATGTGATTGAAGGCACC
AAGGCTGTGCTTGAATGTAAGGTGTCAGTCCCTGATGTGACTTCTGTTAAGTGGTACTTA
AATGATGAACAAATCAAGCCTGATGACCGTGTACAGGCCATTGTGAAAGGTACTAAACAG
CGACTAGTCATTAACCGAACTCATGCTTCAGACGAAGGACCTTACAAGCTGATAGTTGGC
AGAGTTGAAACCAACTGTAATCTCTCTGTAGAAAAAATTAAAATTATCAGAGGTCTTCGT
GACCTTACCTGTACAGAAACTCAAAATGTGGTGTTTGAGGTTGAGCTGTCCCACTCTGGA
ATTGATGTCCTGTGGAATTTTAAGGACAAGGAAATCAAGCCCAGTTCTAAATATAAAATT
GAAGCACATGGAAAAATATATAAATTGACAGTTCTAAATATGATGAAAGATGATGAAGGA
AAATACACATTTTACGCGGGAGAAAATATCACATCTGGAAAACTTACTGTGGCAGGTGGG
GCCATCTCCAAGCCACTCACAGATCAGACCGTAGCTGAATCCCAGGAAGCTGTGTTTGAA
TGTGAAGTTGCCAACCCAGATTCCAAAGGCGAATGGTTGAGGGATGGCAAACACCTACCA
CTGACTAACAACATCAGAAGTGAGTCTGATGGCCACAAAAGGAGACTTATCATTGCTGCC
ACCAAATTAGATGACATTGGAGAATATACCTACAAGGTGGCCACCTCCAAAACATCTGCC
AAACTCAAAGTTGAAGCTGTCAAAATTAAGAAGACTCTGAAGAACCTCACAGTGACAGAA
ACACAGGATGCTGTTTTCACTGTCGAGCTTACACACCCTAATGTCAAAGGTGTCCAGTGG
ATCAAAAATGGAGTTGTGCTGGAATCCAATGAAAAGTATGCTATCTCTGTCAAAGGAACA
ATTTACTCTCTGAGGATTAAAAACTGTGCCATCGTGGATGAGTCTGTTTATGGCTTCAGG
CTTGGAAGGCTTGGAGCCAGTGCCAGACTGCACGTGGAGACTGTCAAGATCATTAAAAAG
CCAAAGGATGTGACAGCCTTGGAAAATGCCACTGTTGCCTTTGAAGTTAGTGTTTCCCAT
GACACTGTTCCAGTAAAATGGTTCCATAAGAATGTGGAAATTAAGCCAAGTGACAAACAC
AGACTGGTCTCAGAAAGGAAAGTCCACAAGCTGATGCTGCAGAACATCTCCCCCTCAGAT
GCTGGGGAATACACAGCTGTGGTCGGGCAATTGGAATGCAAAGCAAAACTGTTTGTGGAG
ACATTACATATTACAAAAACCATGAAAAATATCGAGGTGCCTGAGACCAAAACTGCCTCT
TTTGAGTGTGAGGTGTCCCACTTCAATGTCCCTTCCATGTGGCTGAAGAATGGTGTGGAA
ATTGAGATGAGTGAAAAGTTCAAGATAGTTGTGCAGGGAAAACTCCATCAGCTGATCATC
ATGAACACCAGCACAGAGGACTCGGCAGAATACACATTTGTCTGTGGCAATGACCAAGTC
AGTGCCACCCTGACAGTCACCCCAATCATGATTACTTCCATGCTGAAAGACATCAACGCT
GAAGAAAAAGACACTATTACTTTTGAGGTGACAGTGAACTATGAAGGCATCTCTTACAAA
TGGTTAAAGAATGGTGTGGAAATCAAATCAACTGACAAGTGCCAGATGAGAACCAAAAAG
CTCACACACTCACTGAACATCAGGAATGTTCACTTTGGGGATGCTGCTGACTACACCTTT
GTGGCTGGAAAAGCAACATCAACAGCCACACTTTATGTGGAAGCTCGTCATATAGAATTT
AGGAAACACATTAAGGACATTAAGGTACTGGAGAAGAAGCGAGCCATGTTTGAATGTGAA
GTTTCTGAACCTGACATCACTGTACAGTGGATGAAAGATGACCAGGAACTGCAGATCACA
GACAGAATAAAGATTCAGAAGGAGAAATATGTCCACCGCCTTCTGATCCCATCCACCCGG
ATGTCTGATGCTGGGAAGTACACAGTGGTGGCAGGAGGCAACGTGTCAACTGCAAAACTC
TTTGTAGAAGGCAGAGATGTTCGCATCCGAAGTATTAAAAAGGAGGTTCAGGTCATTGAG
AAACAGCGTGCTGTTGTTGAATTTGAGGTCAATGAAGACGATGTTGATGCCCACTGGTAT
AAAGATGGCATTGAAATCAATTTCCAAGTTCAAGAACGACACAAATATGTAGTGGAGAGA
AGAATCCACCGAATGTTTATCTCTGAGACCAGACAGAGCGATGCAGGAGAATACACCTTT
GTGGCAGGAAGGAACAGGAGTTCTGTCACTCTCTATGTCAATGCTCCTGAACCGCCCCAA
GTTCTGCAGGAGCTCCAGCCTGTCACTGTGCAGTCTGGCAAGCCTGCCCGCTTCTGTGCC
GTGATATCCGGAAGACCACAGCCCAAAATTTCCTGGTACAAGGAAGAGCAGCTGCTTTCC
ACTGGCTTCAAGTGCAAATTTCTTCATGATGGGCAAGAGTACACGCTTTTGCTAATTGAA
GCCTTCCCAGAGGATGCGGCAGTCTATACCTGTGAAGCCAAGAATGACTATGGTGTTGCC
ACAACATCAGCTTCACTCTCAGTGGAAGTTCCAGAAGTTGTGTCTCCTGATCAGGAAATG
CCTGTTTATCCACCTGCCATCATCACCCCGCTTCAGGACACTGTCACTTCTGAAGGGCAG
CCAGCCCGTTTTCAATGCCGGGTTTCTGGAACAGATCTAAAAGTGTCGTGGTACAGCAAA
GACAAGAAAATCAAGCCATCTCGGTTCTTTAGAATGACTCAATTTGAAGACACTTATCAA
CTGGAAATTGCCGAAGCTTATCCAGAAGATGAAGGAACTTACACGTTTGTTGCTAGTAAT
GCTGTAGGCCAAGTATCAAGCACAGCCAACCTGAGTCTGGAAGCTCCTGAATCAATTTTG
CATGAGAGGATTGAACAAGAGATTGAGATGGAAATGAAAGAGTTTTCTAGTTCTTTTCTG
TCTGCCGAGGAAGAAGGACTTCATAGCGCCGAACTTCAATTATCTAAAATAAATGAAACA
CTTGAACTTTTGTCTGAATCTCCAGTTTACTCAACTAAATTTGATTCCGAAAAGGAAGGC
ACTGGCCCAATTTTCATCAAAGAAGTGTCAAATGCTGATATAAGCATGGGGGATGTGGCT
ACACTGTCTGTAACTGTCATTGGCATCCCCAAACCTAAAATTCAGTGGTTCTTTAATGGA
GTGCTATTAACCCCTTCTGCTGACTACAAATTTGTTTTTGACGGTGATGATCATAGCCTG
ATCATTCTGTTCACCAAATTGGAGGATGAGGGAGAGTATACATGTATGGCCAGTAATGAC
TATGGAAAGACAATATGTAGTGCCTATCTAAAAATTAATTCCAAAGGAGAGGGTCACAAA
GACACTGAAACAGAATCAGCAGTGGCAAAATCTCTGGAAAAGCTGGGAGGTCCTTGTCCT
CCTCACTTCCTTAAGGAGTTAAAACCAATTCGCTGTGCTCAAGGGCTTCCTGCCATCTTT
GAGTACACAGTGGTTGGAGAGCCTGCCCCTACTGTTACATGGTTCAAAGAAAACAAGCAG
CTTTGCACCAGTGTTTATTACACTATCATTCATAACCCTAATGGCTCTGGAACTTTCATT
GTCAATGACCCTCAGAGGGAAGACAGTGGCCTCTATATCTGTAAAGCAGAGAATATGTTG
GGTGAGTCCACCTGTGCAGCAGAGCTGCTTGTGCTTCTGGAAGACACAGACATGACTGAT
ACCCCCTGCAAAGCAAAGTCCACACCAGAGGCTCCTGAGGATTTTCCACAGACACCCTTA
AAGGGTCCCGCAGTTGAAGCACTTGACTCAGAGCAGGAAATTGCAACGTTTGTAAAAGAC
ACCATTTTGAAAGCTGCTTTAATCACAGAAGAAAACCAGCAACTATCTTATGAGCATATT
GCTAAAGCCAATGAATTGAGCAGTCAGCTTCCTTTGGGAGCTCAGGAATTGCAATCCATT
TTGGAGCAAGACAAGCTCACTCCTGAAAGCACCAGGGAATTTCTTTGCATCAATGGCAGT
ATTCACTTTCAGCCTCTCAAGGAACCATCTCCCAACCTACAGCTGCAGATTGTACAGTCC
CAGAAAACCTTCTCCAAAGAAGGTATTCTAATGCCTGAAGAGCCTGAGACACAGGCAGTT
CTATCAGATACCGAGAAAATCTTCCCAAGTGCCATGTCCATAGAACAAATTAATTCATTA
ACAGTTGAGCCTCTGAAAACTTTATTAGCTGAACCTGAAGGGAATTATCCACAGTCTTCA
ATAGAACCTCCAATGCATTCTTATCTAACCTCTGTGGCTGAGGAAGTACTTTCACCAAAA
GAAAAGACAGTATCTGACACCAACAGAGAGCAAAGAGTGACTCTTCAAAAGCAAGAGGCA
CAAAGTGCTCTCATCTTGAGTCAGAGCTTAGCTGAGGGACACGTGGAGAGTCTCCAGAGT
CCTGATGTCATGATCTCTCAGGTAAACTATGAGCCCCTAGTCCCTTCAGAACACTCATGC
ACAGAAGGAGGTAAAATTTTGATAGAAAGTGCAAATCCACTGGAAAATGCAGGGCAAGAT
TCTGCGGTCAGAATTGAGGAAGGCAAGTCCTTAAGATTTCCACTAGCACTTGAAGAAAAG
CAGGTACTGCTCAAAGAAGAGCATTCTGACAACGTGGTGATGCCCCCAGACCAAATCATT
GAGTCTAAAAGAGAGCCCGTGGCAATAAAGAAAGTGCAGGAGGTACAGGGAAGGGACCTT
CTTTCTAAGGAAAGCTTGCTTTCTGGTATTCCAGAAGAGCAGAGATTAAACCTGAAAATT
CAAATCTGCCGGGCTTTGCAAGCAGCTGTGGCCAGCGAGCAGCCAGGTCTTTTCTCTGAG
TGGCTAAGAAATATTGAAAAGGTGGAGGTCGAGGCTGTAAACATCACCCAAGAGCCCAGA
CACATCATGTGCATGTACCTTGTTACTTCGGCAAAGTCTGTAACAGAAGAAGTAACCATC
ATTATTGAAGATGTTGATCCTCAAATGGCTAACCTGAAAATGGAACTTAGGGATGCTTTG
TGTGCTATTATATATGAGGAAATAGACATCCTAACAGCTGAGGGTCCTAGAATTCAGCAA
GGAGCCAAAACAAGTTTGCAAGAAGAAATGGATTCTTTTTCAGGTTCACAGAAGGTTGAA
CCCATTACTGAACCAGAAGTTGAATCTAAATATCTGATCTCACCTGAAGAGGTCAGTTAT
TTTAACGTGCAAAGTAGGGTTAAATATTTGGATGCCACACCTGTCACTAAAGGGGTTGCT
TCAGCTGTTGTCTCTGACGAAAAACAAGATGAGAGTCTGAAACCATCAGAGGAAAAAGAG
GAGTCTTCCTCTGAAAGTGGTACTGAGGAGGTTGCTACAGTAAAGATACAGGAAGCTGAG
GGTGGCTTCATCAAAGAGGATGGCCCCATGATACATACACCTTTAGTGGACACTGTTTCT
GAGGAAGGTGATATTGTACACCTCACAACATCCATAACAAATGCTAAAGAGGTGAATTGG
TATTTTGAGAATAAACTGGTGCCTTCAGATGAAAAGTTCAAGTGTTTACAAGATCAAAAT
ACATATACGCTAGTCATCGACAAAGTAAATACCGAAGACCATCAAGGAGAGTATGTCTGT
GAGGCCTTGAATGACAGCGGAAAAACAGCAACTTCAGCCAAACTCACTGTAGTAAAAAGA
GCTGCCCCAGTGATCAAGAGGAAAATCGAACCCCTGGAAGTAGCACTGGGCCACCTAGCC
AAATTCACCTGTGAGATCCAAAGTGCTCCCAATGTCCGGTTCCAGTGGTTTAAAGCTGGC
CGAGAAATTTATGAGAGTGACAAGTGTTCTATTCGATCTTCAAAGTATATCTCCAGCCTT
GAAATCCTGAGAACCCAGGTGGTTGACTGCGGCGAGTATACATGCAAAGCTTCCAATGAG
TATGGCAGTGTCAGCTGTACAGCCACACTAACTGTGACAGAGGCATATCCACCAACCTTT
CTCTCCAGACCTAAGTCCCTTACAACTTTTGTGGGTAAGGCAGCCAAGTTCATCTGCACA
GTGACAGGGACTCCTGTGATAGAAACCATTTGGCAGAAAGATGGTGCTGCACTCTCACCT
TCACCTAACTGGAAGATTTCCGACGCAGAAAACAAACACATTTTAGAACTCTCAAACCTT
ACCATTCAAGATAGAGGAGTTTATTCTTGTAAGGCTTCTAACAAGTTTGGAGCAGACATC
TGCCAAGCAGAGTTGATCATCATTGATAAGCCACATTTCATTAAAGAATTAGAGCCTGTG
CAGTCCGCTATCAATAAGAAGGTCCACCTTGAGTGCCAAGTAGATGAAGACAGAAAAGTC
ACAGTTACGTGGAGCAAAGATGGGCAAAAACTCCCCCCAGGGAAAGATTATAAGATCTGT
TTTGAAGATAAAATAGCAACACTTGAGATTCCTTTGGCCAAACTGAAAGATTCAGGAACC
TATGTCTGTACAGCTTCAAATGAGGCTGGAAGCAGCTCCTGCTCAGCCACAGTCACTGTC
AGAGAGCCACCATCCTTCGTGAAGAAGGTGGATCCCTCTTATTTAATGCTCCCAGGTGAA
TCAGCACGCCTCCATTGCAAGCTGAAAGGCTCACCTGTGATCCAGGTTACTTGGTTTAAA
AATAACAAAGAACTCAGTGAAAGTAACACAGTCCGAATGTATTTTGTCAATTCTGAGGCT
ATACTTGATATTACGGATGTAAAAGTTGAAGACAGTGGGAGTTACTCATGTGAAGCAGTG
AATGACGTCGGCAGTGATAGCTGCAGTACTGAAATAGTTATCAAAGAACCTCCTTCTTTC
ATCAAAACTCTTGAGCCTGCAGACATAGTGAGAGGAACAAATGCTCTACTTCAGTGTGAA
GTCTCAGGCACTGGACCATTTGAAATTAGCTGGTTCAAAGACAAGAAACAAATTCGAAGT
AGTAAAAAATACAGATTGTTTTCTCAGAAGTCTCTTGTGTGTCTGGAGATCTTTTCGTTT
AATAGTGCAGATGTTGGTGAATATGAATGTGTTGTTGCTAATGAAGTCGGCAAGTGTGGC
TGCATGGCAACCCACTTACTCAAAGAACCTCCAACCTTTGTAAAGAAAGTAGATGATTTG
ATTGCACTAGGAGGACAAACCGTTACCCTGCAAGCTGCTGTGAGAGGGTCAGAGCCCATT
TCTGTCACATGGATGAAAGGTCAAGAGGTCATCAGAGAAGACGGAAAAATCAAAATGAGC
TTTTCCAATGGTGTTGCAGTCTTGATAATCCCTGATGTTCAGATTAGTTTTGGAGGCAAA
TACACGTGCCTGGCTGAAAATGAAGCTGGAAGCCAAACATCTGTTGGGGAATTAATAGTT
AAAGAACCTGCCAAAATCATTGAGCGAGCAGAACTGATCCAGGTGACAGCAGGAGATCCC
GCCACACTGGAGTACACAGTGGCAGGCACGCCAGAACTGAAGCCCAAATGGTACAAAGAT
GGGAGACCCTTGGTCGCCAGTAAAAAATACCGAATAAGTTTTAAAAACAATGTTGCCCAG
CTCAAATTTTATTCAGCTGAGCTGCACGACAGTGGCCAATACACATTTGAGATTTCCAAT
GAAGTGGGCAGCAGCTCCTGTGAGACTACATTCACTGTATTAGATCGAGACATTGCTCCA
TTTTTTACCAAACCCTTGCGCAACGTGGATAGTGTTGTTAATGGTACCTGCAGACTGGAC
TGCAAAATTGCAGGCTCCCTCCCCATGAGGGTGTCCTGGTTTAAGGATGGCAAAGAAATA
GCTGCTTCTGACAGATACAGGATAGCATTTGTGGAAGGCACAGCCTCTTTGGAGATCATC
AGAGTAGACATGAATGATGCAGGGAATTTCACTTGTCGAGCCACAAATTCCGTGGGAAGC
AAAGACAGCAGTGGAGCCCTGATTGTGCAAGAACCACCCAGTTTTGTAACTAAACCCGGC
TCAAAGGATGTTCTGCCTGGCTCAGCAGTCTGCCTGAAGAGCACTTTCCAAGGATCTACT
CCTCTCACAATCAGATGGTTTAAGGGCAACAAAGAGCTGGTTTCTGGTGGAAGCTGCTAT
ATTACCAAAGAAGCTTTAGAGAGTTCCCTGGAACTCTATTTAGTAAAAACCTCTGATTCG
GGCACGTACACATGTAAAGTCAGCAATGTCGCTGGAGGGGTGGAATGCAGTGCAAACTTG
TTTGTAAAAGAACCTGCCACATTTGTTGAAAAGTTAGAGCCATCACAGCTGTTAAAGAAG
GGAGATGCCACCCAGCTAGCCTGCAAAGTAACTGGTACCCCTCCAATTAAAATAACATGG
TTTGCAAATGATAGAGAAATTAAGGAGAGCAGCAAACACAGAATGTCTTTTGTGGAGTCT
ACTGCAGTTCTAAGACTGACAGATGTTGGCATCGAAGACAGTGGTGAATATATGTGTGAG
GCCCAAAATGAGGCTGGCAGTGACCACTGCAGTAGCATTGTAATAGTCAAAGAGTCACCT
TATTTTACCAAGGAATTTAAGCCAATTGAAGTCTTAAAGGAGTACGATGTCATGTTGCTG
GCTGAGGTGGCAGGCACTCCTCCCTTTGAGATCACTTGGTTCAAAGATAACACAATCCTG
CGAAGTGGTAGAAAGTATAAGACTTTCATTCAGGATCATCTGGTTAGCCTGCAGATCCTC
AAGTTTGTAGCTGCAGATGCTGGCGAATACCAGTGTCGGGTGACCAATGAGGTGGGCAGC
AGCATCTGCAGTGCCAGGGTGACTTTAAGAGAACCCCCATCCTTCATAAAGAAGATCGAG
AGTACCAGCTCCCTCCGGGGAGGCACAGCTGCCTTCCAGGCCACTCTGAAGGGCTCCTTG
CCAATTACGGTGACTTGGCTAAAAGACAGCGATGAAATCACTGAAGACGATAATATAAGA
ATGACCTTTGAGAACAATGTGGCCAGTTTGTACCTCAGTGGCATTGAAGTCAAGCATGAT
GGGAAATATGTCTGTCAGGCCAAAAATGATGCAGGAATACAAAGATGTTCTGCATTACTC
TCAGTAAAAGAACCTGCAACAATCACCGAGGAAGCTGTGTCTATAGATGTCACCCAAGGA
GACCCAGCCACTTTGCAGGTTAAATTTTCAGGGACTAAGGAGATTACAGCCAAATGGTTT
AAAGATGGCCAAGAACTGACCCTGGGCTCAAAATATAAAATCAGTGTCACTGATACAGTC
TCAATACTGAAGATTATTTCTACAGAAAAGAAAGATAGTGGAGAATATACTTTCGAGGTC
CAAAATGATGTTGGGAGGAGCAGCTGCAAGGCTAGAATTAATGTATTAGATCTTATCATA
CCTCCTTCATTCACCAAAAAGCTGAAGAAAATGGACAGCATTAAAGGTTCTTTCATTGAT
TTAGAATGTATAGTGGCTGGGTCACATCCCATAAGCATCCAGTGGTTCAAAGATGACCAA
GAAATATCAGCTAGTGAAAAGTACAAATTCTCTTTTCATGACAATACTGCCTTCTTGGAA
ATCAGCCAGCTGGAAGGTACAGACAGTGGGACATACACTTGTTCTGCCACAAATAAGGCA
GGGCACAACCAATGCAGTGGGCATCTGACAGTCAAAGAACCCCCTTACTTTGTGGAAAAG
CCACAGTCACAAGATGTCAATCCCAACACAAGGGTACAGTTAAAGGCTCTTGTGGGTGGC
ACTGCACCCATGACAATAAAGTGGTTTAAAGATAACAAAGAGTTACACTCAGGAGCAGCC
CGCTCAGTTTGGAAGGATGACACCTCTACCAGTCTAGAGCTCTTTGCAGCCAAAGCTACC
GATTCTGGAACCTACATTTGCCAACTAAGCAATGATGTTGGCACAGCAACCAGCAAAGCC
ACTCTCTTTGTAAAAGAACCTCCTCAATTCATTAAGAAGCCCAGTCCAGTCTTAGTGCTG
AGGAATGGACAGTCAACAACATTTGAATGCCAAATAACAGGCACTCCTAAAATCCGAGTG
TCTTGGTATCTAGACGGGAATGAAATAACAGCCATTCAGAAACATGGCATTTCCTTCATT
GATGGTTTAGCCACTTTCCAGATTTCTGGTGCCAGGGTAGAAAATAGTGGGACTTATGTG
TGTGAAGCTCGAAATGACGCAGGCACGGCGAGCTGCAGCATTGAACTCAAAGTGAAAGAA
CCCCCCACCTTTATCAGAGAGCTGAAGCCTGTGGAGGTAGTAAAATATAGTGACGTGGAG
CTGGAGTGTGAAGTTACGGGAACACCTCCGTTTGAAGTCACTTGGCTGAAGAATAACAGG
GAAATTCGAAGCAGCAAAAAATACACATTGACCGACAGAGTGTCTGTGTTTAACCTCCAT
ATAACCAAGTGTGACCCTTCAGACACTGGGGAATACCAGTGCATTGTATCCAATGAAGGC
GGCAGCTGCTCATGCAGTACTAGAGTTGCCCTGAAAGAACCACCATCATTCATTAAGAAG
ATAGAAAATACCACTACTGTTTTGAAAAGTTCTGCCACCTTTCAGAGTACCGTGGCAGGT
TCTCCTCCTATTTCTATAACCTGGCTAAAGGATGATCAGATTCTTGATGAAGATGATAAT
GTCTATATTTCATTTGTGGACAGTGTGGCCACACTTCAAATCAGAAGTGTGGATAATGGA
CACAGTGGGAGATATACCTGTCAAGCCAAGAATGAGTCAGGAGTTGAGAGGTGTTATGCT
TTCCTTTTAGTACAAGAACCAGCTCAAATCGTAGAGAAAGCTAAATCAGTTGATGTTACG
GAGAAAGATCCCATGACCTTGGAATGTGTTGTGGCTGGAACACCAGAACTCAAAGTGAAA
TGGCTTAAAGACGGGAAACAAATAGTTCCCAGTAGATACTTTTCAATGAGTTTTGAAAAT
AACGTGGCCAGTTTTAGAATTCAGTCAGTAATGAAGCAGGACAGCGGTCAGTACACTTTC
AAGGTGGAAAATGACTTCGGAAGCAGTAGCTGTGATGCCTACTTAAGAGTGCTAGATCAA
AATATTCCTCCATCATTCACCAAAAAATTAACCAAAATGGATAAAGTTCTGGGCTCTTCT
ATTCATATGGAGTGCAAGGTGTCTGGTTCACTTCCCATTAGTGCTCAGTGGTTTAAGGAT
GGAAAAGAAATATCTACAAGTGCAAAATACAGACTTGTGTGCCATGAGAGATCTGTGTCT
CTGGAAGTTAATAATCTGGAATTAGAAGATACTGCAAATTACACATGCAAAGTGTCAAAT
GTAGCAGGAGATGATGCATGCAGTGGCATCTTAACTGTGAAAGAACCACCAAGCTTCCTA
GTGAAACCTGGGCGACAGCAAGCCATACCTGATTCTACAGTGGAATTTAAGGCAATACTA
AAAGGAACACCACCATTTAAAATAAAATGGTTTAAGGATGATGTGGAACTTGTCTCAGGT
CCTAAATGTTTCATTGGCTTGGAAGGGTCGACTAGCTTCTTAAATCTCTACTCAGTGGAT
GCTTCTAAGACTGGACAGTATACTTGCCATGTTACCAATGATGTTGGTAGCGACTCTTGT
ACTACGATGTTGCTTGTGACAGAACCACCAAAGTTTGTAAAGAAATTAGAAGCCTCCAAA
ATTGTGAAAGCAGGTGACTCTTCACGACTTGAATGCAAGATAGCTGGATCCCCAGAAATC
AGAGTTGTGTGGTTCCGAAATGAACATGAACTTCCAGCCAGTGATAAGTACAGAATGACT
TTCATTGACTCAGTGGCCGTCATACAGATGAACAATCTCAGTACTGAGGACAGTGGAGAT
TTCATTTGTGAGGCTCAGAATCCCGCTGGCAGCACAAGCTGCAGTACCAAGGTTATAGTA
AAAGAGCCACCTGTTTTTAGCAGCTTCCCTCCTATAGTAGAAACCCTTAAAAATGCTGAA
GTCAGTCTTGAATGTGAACTTTCGGGAACACCACCGTTTGAGGTGGTATGGTACAAAGAC
AAGCGGCAACTCAGAAGCAGCAAGAAATACAAGATTGCATCCAAAAACTTCCACACAAGT
ATTCACATTCTCAATGTGGACACTTCAGACATCGGTGAATACCACTGCAAAGCACAGAAT
GAAGTGGGAAGTGATACTTGTGTTTGTACTGTAAAATTGAAAGAACCACCAAGATTTGTC
TCCAAACTGAACAGCCTCACTGTTGTAGCCGGAGAGCCTGCTGAATTACAAGCATCCATA
GAAGGCGCCCAGCCTATTTTTGTCCAGTGGCTTAAAGAGAAGGAAGAAGTGATTAGAGAA
AGTGAAAACATCAGGATTACATTTGTGGAAAATGTTGCAACTCTACAGTTTGCAAAAGCA
GAGCCAGCTAATGCTGGAAAGTATATCTGCCAAATCAAGAATGATGGTGGAATGGAGGAG
AACATGGCCACACTGATGGTCTTAGAGCCCGCAGTCATTGTTGAGAAGGCAGGACCGATG
ACGGTGACTGTAGGAGAAACGTGCACTCTGGAGTGTAAGGTGGCTGGCACTCCGGAACTC
TCTGTTGAATGGTACAAGGATGGAAAGCTGTTGACCAGCAGCCAAAAACACAAATTTAGC
TTCTACAACAAAATCTCTTCCTTAAGGATTCTCTCAGTTGAAAGGCAAGATGCAGGCACA
TACACTTTCCAGGTTCAAAATAATGTTGGGAAAAGCAGCTGCACAGCTGTGGTTGATGTT
TCAGACCGAGCAGTTCCTCCCTCTTTCACACGAAGACTGAAAAATACTGGTGGGGTGTTA
GGTGCTTCTTGCATCTTGGAATGCAAAGTAGCTGGATCATCACCTATTTCAGTTGCCTGG
TTTCATGAGAAAACCAAGATTGTCAGTGGAGCAAAGTACCAAACCACATTTTCAGATAAT
GTCTGCACATTGCAGTTGAATTCTCTGGATTCCTCAGATATGGGCAATTACACATGCGTG
GCTGCTAATGTCGCTGGGTCTGATGAATGTCGTGCAGTGCTAACTGTACAAGAACCACCC
TCTTTTGTGAAAGAACCTGAACCTTTGGAAGTACTACCAGGCAAAAATGTAACCTTCACA
AGCGTTATTAGAGGAACCCCTCCATTCAAAGTCAACTGGTTCAGAGGTGCCAGAGAACTA
GTGAAAGGAGACCGGTGCAACATCTATTTTGAAGACACTGTGGCAGAACTGGAATTATTT
AATATTGACATATCTCAGAGTGGGGAATACACCTGTGTGGTTTCTAACAACGCTGGCCAA
GCATCTTGCACTACCCGTCTCTTTGTGAAAGAACCAGCTGCATTTTTGAAGAGATTAAGT
GATCATTCTGTAGAACCAGGGAAGTCCATAATTCTGGAGAGCACCTACACTGGAACACTT
CCAATTTCTGTCACTTGGAAAAAGGATGGTTTTAACATAACTACCTCTGAAAAATGTAAC
ATAGTCACAACAGAGAAAACTTGTATCCTGGAAATTCTGAATAGCACAAAAAGAGATGCA
GGGCAGTATTCCTGCGAGATTGAAAATGAGGCAGGAAGGGATGTTTGTGGAGCTCTGGTA
TCTACATTAGAACCGCCTTATTTTGTTACGGAACTGGAACCTCTGGAGGCAGCAGTTGGA
GATTCGGTTTCTTTACAATGCCAAGTTGCTGGGACACCAGAAATTACAGTGTCTTGGTAC
AAAGGAGATACCAAATTACGGCCAACTCCTGAATACAGGACCTACTTTACAAACAATGTG
GCCACACTTGTTTTTAATAAAGTGAACATCAATGACAGTGGAGAGTACACATGCAAAGCA
GAAAATAGTATAGGAACTGCTTCTTCTAAGACTGTGTTCAGAATTCAAGAGCGCCAACTC
CCACCTTCTTTTGCAAGACAATTAAAGGACATTGAACAAACTGTGGGGTTACCTGTTACA
CTCACTTGTCGATTAAATGGCTCTGCACCCATCCAAGTGTGCTGGTATAGAGATGGAGTA
CTTTTAAGAGACGATGAAAATCTACAGACTTCATTTGTAGATAATGTGGCAACTTTAAAA
ATTTTGCAAACTGACTTGAGTCACTCTGGCCAGTACTCTTGCTCAGCTTCCAACCCACTT
GGAACAGCATCTTCTAGTGCTAGACTCACAGCAAGAGAACCCAAGAAATCTCCCTTCTTT
GACATCAAGCCTGTATCTATAGATGTTATTGCTGGAGAAAGTGCTGATTTTGAGTGTCAT
GTTACTGGTGCTCAACCGATGCGAATCACTTGGTCAAAAGATAACAAGGAGATCCGTCCT
GGAGGAAACTATACAATCACATGTGTGGGAAACACTCCTCATTTGAGAATTCTTAAAGTA
GGCAAAGGAGACTCTGGTCAATATACTTGCCAAGCAACCAATGATGTTGGCAAAGACATG
TGCTCAGCTCAGCTCAGTGTAAAAGAACCTCCAAAGTTTGTTAAGAAATTAGAAGCTTCA
AAAGTTGCAAAGCAGGGAGAATCCATTCAACTGGAATGTAAAATAAGTGGCTCCCCAGAA
ATCAAAGTTTCATGGTTCCGAAATGACAGCGAACTTCATGAAAGTTGGAAATACAACATG
TCATTCATTAATTCTGTGGCATTGCTTACGATCAATGAAGCTAGTGCTGAAGACAGCGGG
GACTACATTTGTGAGGCTCATAATGGTGTTGGTGACGCCAGCTGCAGCACAGCGTTGACA
GTGAAAGCACCTCCTGTTTTCACCCAGAAGCCTTCTCCAGTAGGAGCTCTTAAAGGTTCT
GATGTGATTCTCCAATGTGAAATTTCGGGAACTCCCCCATTTGAAGTAGTATGGGTTAAA
GATCGAAAGCAAGTTAGAAACAGCAAGAAATTTAAAATCACTTCAAAACATTTTGATACA
AGTCTTCATATCCTTAATCTTGAAGCCTCCGATGTCGGGGAATATCACTGCAAAGCTACT
AATGAGGTGGGAAGTGACACGTGTTCTTGCTCTGTCAAGTTCAAAGAACCTCCACGATTC
GTGAAAAAGCTAAGTGACACCTCAACCCTTATTGGGGATGCTGTTGAGTTACGGGCCATA
GTGGAGGGCTTCCAGCCAATTTCTGTTGTCTGGCTGAAAGATAGAGGTGAAGTCATCAGA
GAGAGTGAAAATACCAGGATTTCATTCATTGATAACATTGCAACCCTCCAGCTGGGGAGT
CCAGAAGCATCTAATTCTGGAAAATATATATGCCAAATCAAAAACGATGCTGGAATGAGA
GAATGCTCTGCAGTCTTGACTGTACTAGAACCAGCAAGAATCATAGAGAAGCCCGAACCC
ATGACTGTCACTACTGGAAATCCTTTTGCATTAGAGTGTGTAGTGACTGGAACACCAGAA
CTCTCAGCCAAGTGGTTCAAAGATGGAAGAGAATTGTCTGCAGACAGCAAACATCACATT
ACATTCATCAATAAAGTGGCTTCCCTTAAAATCCCCTGTGCCGAAATGAGTGACAAAGGA
TTATATAGCTTTGAAGTGAAAAACAGTGTTGGCAAAAGTAACTGCACTGTATCCGTCCAT
GTTTCTGATCGGATTGTGCCTCCTTCCTTCATCCGCAAGCTGAAAGACGTGAATGCCATC
CTGGGGGCCTCAGTTGTTTTGGAGTGCCGAGTCTCTGGCTCAGCCCCGATTTCAGTTGGC
TGGTTTCAGGATGGAAATGAGATTGTTAGTGGGCCCAAATGTCAGTCCAGCTTTTCGGAA
AACGTCTGTACTTTGAATCTGAGCTTGTTGGAGCCCTCCGACACAGGCATATACACGTGT
GTGGCTGCCAATGTAGCTGGTTCCGATGAGTGCTCAGCAGTCCTGACTGTGCAAGAACCA
CCATCTTTTGAACAAACCCCTGATTCTGTGGAAGTTTTGCCTGGAATGAGCCTCACATTC
ACCAGTGTCATCAGAGGCACCCCTCCTTTCAAGGTCAAGTGGTTTAAAGGCAGCAGGGAA
CTGGTGCCTGGGGAGTCATGCAACATCTCTCTGGAAGATTTTGTCACAGAACTGGAGTTG
TTTGAGGTGCAGCCATTAGAAAGTGGAGACTATTCTTGCCTCGTTACAAATGATGCTGGC
AGTGCTTCCTGTACCACACATCTTTTTGTGAAAGAACCAGCCACCTTTGTGAAAAGATTG
GCTGATTTCAGTGTTGAGACAGGAAGCCCCATAGTTCTCGAGGCCACATACACTGGCACA
CCTCCAATCTCAGTGAGCTGGATAAAGGACGAGTATCTTATTTCACAATCTGAGAGATGC
AGTATTACTATGACAGAAAAATCTACCATACTGGAAATTCTTGAGAGCACAATAGAGGAT
TATGCACAGTACAGCTGCCTGATAGAAAATGAGGCTGGTCAAGATATCTGTGAAGCTCTG
GTGTCTGTCTTAGAACCACCGTACTTTATTGAACCTCTGGAACATGTGGAAGCAGTCATT
GGAGAACCTGCAACTTTACAGTGTAAAGTGGATGGAACTCCAGAAATTAGAATTTCTTGG
TATAAAGAACACACAAAGCTACGATCAGCTCCTGCATATAAAATGCAATTCAAAAATAAC
GTTGCTTCCTTAGTAATCAACAAAGTGGATCACAGTGATGTGGGAGAGTATTCATGCAAG
GCAGACAACAGTGTGGGGGCAGTCGCTTCTTCAGCTGTGCTTGTTATCAAAGAGCGCAAA
CTTCCACCTTTCTTTGCAAGAAAACTGAAAGACGTTCATGAGACTCTAGGCTTCCCAGTT
GCATTTGAATGCCGCATCAATGGCTCAGAACCTCTTCAAGTGTCTTGGTACAAGGATGGG
GTTCTTTTGAAAGATGATGCTAATTTGCAGACATCTTTTGTTCATAATGTAGCAACTCTT
CAGATTTTACAAACTGACCAGAGCCACATAGGGCAGTATAATTGCTCTGCTTCTAATCCT
CTTGGGACTGCTTCATCCAGTGCCAAGCTCATTCTCTCAGAGCATGAAGTGCCTCCTTTC
TTTGATCTAAAGCCTGTATCAGTAGATCTTGCTCTTGGAGAAAGTGGTACTTTTAAATGT
CATGTAACTGGGACTGCACCAATCAAAATCACTTGGGCCAAAGATAACCGAGAGATTCGC
CCTGGAGGCAACTACAAGATGACTTTGGTAGAAAATACTGCCACTCTGACAGTTCTCAAA
GTAGGCAAAGGCGATGCCGGGCAGTACACCTGCTATGCAAGCAACATCGCTGGAAAAGAC
TCTTGTTCTGCTCATCTGGGTGTACAAGAACCACCCAGGTTCATTAAGAAGCTAGAACCT
TCAAGAATTGTGAAACAGGATGAATTCACAAGGTACGAATGCAAAATCGGTGGGTCTCCA
GAAATCAAAGTTTTATGGTATAAGGACGAGACTGAAATTCAAGAGAGCAGTAAATTCAGA
ATGTCATTCGTTGACTCGGTGGCTGTGCTGGAAATGCACAATCTCAGTGTTGAAGACAGT
GGAGACTACACCTGTGAGGCCCACAATGCAGCAGGCAGTGCCAGCAGCAGCACATCCTTA
AAAGTTAAAGAACCACCCATTTTCCGCAAAAAGCCTCATCCTATAGAGACACTGAAAGGA
GCTGATGTTCACCTTGAATGTGAGCTTCAGGGCACTCCCCCATTTCACGTTTCTTGGTAT
AAAGACAAGAGAGAACTTAGGAGCGGCAAGAAGTACAAGATAATGTCTGAGAACTTCCTT
ACCAGTATCCACATCCTGAATGTCGATGCTGCAGACATTGGGGAATATCAGTGTAAAGCC
ACAAATGATGTGGGAAGCGACACTTGCGTTGGTTCCATCGCTCTCAAAGCACCACCAAGA
TTTGTGAAGAAGCTCAGTGACATATCTACTGTCGTTGGTAAAGAAGTTCAGCTGCAGACT
ACCATTGAAGGCGCTGAGCCCATTTCAGTGGTGTGGTTCAAAGATAAGGGAGAAATCGTT
AGAGAAAGTGACAACATATGGATTTCTTATTCAGAAAACATTGCAACCTTACAGTTTTCA
AGAGTGGAACCAGCCAATGCTGGAAAATACACTTGTCAGATCAAAAACGATGCTGGGATG
CAAGAGTGCTTCGCCACGCTATCCGTTCTCGAGCCTGCAACAATTGTAGAAAAGCCAGAA
TCCATAAAAGTTACCACGGGAGACACCTGTACCTTGGAGTGTACAGTAGCTGGCACCCCT
GAACTCAGTACTAAGTGGTTTAAGGATGGAAAAGAGCTAACAAGTGACAACAAATACAAA
ATAAGCTTCTTCAACAAAGTATCTGGCCTTAAGATCATCAATGTAGCACCGAGTGACAGT
GGGGTATACAGTTTTGAGGTGCAGAACCCTGTTGGCAAAGACAGCTGCACAGCTTCATTG
CAGGTTTCAGACCGAACCGTTCCTCCTTCATTCACAAGAAAATTGAAAGAGACAAATGGT
CTATCCGGCTCCTCAGTTGTAATGGAGTGTAAAGTCTATGGGTCACCTCCAATCTCTGTC
TCCTGGTTCCATGAAGGAAATGAGATCAGTAGTGGAAGGAAATACCAGACCACCCTGACA
GATAATACTTGTGCTTTAACTGTGAACATGCTGGAAGAATCAGACAGTGGTGACTACACA
TGTATAGCTACTAATATGGCTGGTTCTGATGAATGTAGTGCTCCTTTGACTGTGAGAGAA
CCACCATCTTTTGTTCAGAAACCTGATCCCATGGATGTTTTAACTGGGACCAATGTAACT
TTCACAAGTATCGTAAAAGGAACACCTCCTTTCAGTGTTAGCTGGTTCAAAGGTAGCAGT
GAACTAGTACCAGGTGACAGATGCAACGTGTCTTTGGAGGATTCAGTTGCTGAACTGGAG
TTGTTCGATGTAGATACATCACAAAGTGGAGAATATACTTGCATAGTTAGCAATGAAGCT
GGCAAGGCTTCTTGTACAACACATCTCTACATAAAAGCCCCAGCCAAATTTGTGAAGAGG
CTGAATGATTACAGCATAGAGAAAGGAAAACCCCTGATCCTAGAGGGTACATTCACTGGA
ACTCCTCCCATTTCGGTTACCTGGAAGAAAAATGGCATAAATGTAACTCCTTCTCAGAGG
TGTAATATAACTACGACTGAAAAATCGGCAATCCTGGAAATTCCAAGTAGCACAGTAGAG
GATGCAGGACAATACAACTGCTACATTGAAAATGCCTCTGGAAAAGATTCCTGTTCAGCA
CAAATACTCATACTAGAACCACCGTATTTTGTCAAGCAGTTGGAGCCGGTTAAGGTGTCT
GTTGGAGATTCTGCCTCTCTACAATGCCAGCTTGCTGGAACCCCTGAAATTGGGGTATCC
TGGTATAAAGGAGATACAAAATTGAGACCCACTACGACTTACAAAATGCATTTTAGGAAT
AATGTTGCTACACTGGTTTTCAACCAGGTTGATATTAATGATAGTGGAGAATATATCTGC
AAAGCTGAAAACAGCGTGGGAGAAGTTTCTGCATCAACTTTCCTTACCGTTCAAGAGCAA
AAACTTCCACCATCATTTTCTCGACAATTGAGAGATGTTCAAGAAACAGTTGGACTGCCA
GTTGTTTTTGATTGTGCCATAAGTGGATCAGAACCTATCTCCGTGTCTTGGTATAAAGAC
GGCAAGCCATTGAAAGACAGCCCAAATGTACAAACATCATTTTTAGACAATACAGCCACA
CTCAATATTTTTAAAACTGACCGGAGCCTTGCAGGCCAGTATTCCTGCACAGCTACAAAC
CCTATAGGCTCTGCTTCTTCCAGTGCCAGGCTCATTCTCACAGAGGGGAAGAACCCACCC
TTCTTTGACATCCGTCTTGCCCCTGTGGATGCTGTGGTGGGAGAAAGTGCTGACTTTGAG
TGCCACGTCACGGGCACACAACCGATAAAGGTCAGCTGGGCCAAAGACAGCAGAGAAATA
CGAAGTGGCGGAAAGTACCAGATTAGTTATCTGGAAAACAGCGCCCACCTGACAGTCCTC
AAAGTAGACAAAGGAGATTCTGGACAATATACCTGCTATGCTGTGAATGAAGTGGGAAAA
GACTCTTGCACAGCTCAGCTGAATATAAAAGAGCGGCTCATCCCACCAAGTTTCACTAAA
AGACTCTCAGAGACAGTAGAAGAAACAGAAGGGAATTCTTTCAAACTTGAGGGACGTGTG
GCTGGTTCCCAACCTATAACTGTTGCCTGGTACAAAAATAATATAGAGATACAACCAACT
TCTAACTGTGAAATAACATTCAAGAACAACACGTTAGTGCTGCAAGTCAGAAAAGCAGGC
ATGAACGACGCTGGTTTGTACACATGCAAAGTGTCCAATGATGCAGGCTCTGCTCTGTGC
ACGTCTTCAATCGTCATCAAAGAACCTAAGAAGCCACCTGTATTTGATCAGCACCTTACT
CCAGTAACAGTGAGTGAAGGAGAATACGTGCAGCTCAGCTGCCATGTCCAGGGATCTGAG
CCAATTAGGATCCAGTGGTTGAAGGCTGGCAGGGAAATAAAGCCTTCAGACAGATGCAGC
TTCAGCTTTGCTAGTGGGACAGCTGTACTGGAACTCAGAGATGTGGCTAAAGCAGATTCG
GGAGATTATGTGTGTAAAGCTTCAAATGTGGCTGGAAGTGACACTACCAAATCAAAAGTG
ACCATTAAAGACAAACCAGCTGTGGCCCCAGCAACCAAGAAAGCTGCGGTAGATGGAAGA
CTCTTTTTTGTGTCAGAACCTCAGAGTATCAGAGTCGTAGAAAAAACCACTGCGACCTTC
ATTGCAAAAGTTGGAGGTGACCCAATCCCAAATGTTAAATGGACAAAAGGGAAGTGGAGA
CAGCTGAACCAAGGAGGTCGTGTTTTCATCCACCAAAAAGGCGATGAAGCAAAACTGGAG
ATTAGGGACACCACAAAAACTGATTCTGGGTTATACCGATGCGTGGCATTTAACGAACAT
GGTGAAATTGAAAGTAATGTTAACTTACAGGTGGATGAAAGGAAGAAACAAGAGAAAATT
GAAGGCGATCTTAGAGCAATGCTGAAAAAGACTCCAATCTTAAAGAAAGGAGCTGGAGAA
GAAGAGGAAATTGATATCATGGAACTTCTCAAAAATGTTGATCCTAAAGAATATGAAAAA
TATGCCCGCATGTATGGAATCACTGACTTCCGAGGTCTTCTTCAAGCATTTGAACTGCTC
AAGCAAAGCCAAGAAGAAGAGACACATAGACTGGAAATTGAGGAAATAGAGAGGTCAGAG
AGGGACGAAAAGGAATTTGAGGAACTTGTATCATTTATTCAGCAAAGACTGTCACAGACA
GAGCCTGTCACTCTGATCAAGGACATTGAAAATCAGACAGTTTTGAAAGATAATGATGCT
GTCTTTGAAATCGACATTAAAATTAATTATCCAGAAATCAAGCTTTCATGGTACAAAGGA
ACTGAAAAACTGGAACCCAGTGATAAATTTGAAATAAGCATTGATGGTGACCGACATACA
CTCAGAGTCAAAAACTGTCAACTTAAAGACCAGGGCAATTATCGATTGGTTTGTGGTCCA
CACATCGCTAGCGCTAAACTAACTGTAATTGAGCCTGCATGGGAACGGCATCTTCAGGAT
GTGACTCTGAAAGAAGGCCAGACTTGCACCATGACATGCCAATTTTCTGTACCAAATGTA
AAATCTGAATGGTTCAGAAATGGCAGAATCCTTAAACCCCAAGGTAGACATAAAACAGAA
GTGGAACACAAAGTCCATAAATTGACCATTGCAGATGTTCGAGCAGAAGACCAGGGTCAG
TACACCTGCAAATATGAAGACCTTGAAACTTCAGCAGAACTCAGAATCGAAGCTGAACCA
ATTCAGTTTACAAAGCGCATACAGAACATCGTGGTGAGTGAGCATCAGTCTGCCACCTTT
GAGTGTGAAGTGTCCTTTGATGATGCCATTGTAACATGGTACAAAGGACCAACAGAACTG
ACAGAGAGCCAGAAATACAACTTCAGGAATGATGGCCGCTGCCATTATATGACCATCCAC
AATGTGACCCCAGACGATGAAGGTGTCTACTCGGTCATCGCTCGGCTGGAGCCAAGAGGT
GAAGCAAGAAGCACGGCAGAGCTGTACCTAACGACGAAAGAAATCAAACTTGAGCTGAAG
CCTCCTGATATTCCTGACTCCAGAGTTCCAATCCCAACCATGCCTATCAGAGCAGTGCCA
CCAGAAGAAATCCCTCCTGTGGTTGCTCCTCCTATCCCCCTTTTGCTACCAACACCCGAA
GAAAAGAAACCACCACCAAAACGTATTGAAGTTACCAAAAAGGCTGTGAAGAAAGATGCC
AAAAAAGTTGTTGCAAAGCCCAAAGAGATGACACCACGTGAAGAGATTGTCAAGAAGCCT
CCACCTCCTACTACCTTAATTCCAGCAAAAGCTCCTGAAATCATTGATGTATCCTCTAAA
GCTGAAGAAGTAAAAATAATGACTATAACCAGAAAGAAAGAGGTTCAGAAAGAAAAAGAA
GCTGTGTATGAGAAAAAGCAAGCAGTCCACAAGGAGAAGAGAGTCTTCATTGAATCTTTC
GAAGAACCTTATGACGAACTGGAGGTAGAACCATACACAGAGCCATTTGAACAACCTTAT
TATGAAGAACCAGATGAAGACTATGAAGAGATTAAGGTAGAAGCTAAAAAAGAAGTTCAC
GAGGAATGGGAAGAAGATTTTGAAGAAGGGCAAGAATACTATGAAAGGGAAGAAGGCTAT
GACGAAGGGGAGGAAGAGTGGGAAGAGGCTTACCAAGAAAGGGAAGTAATTCAAGTTCAA
AAGGAGGTCTATGAAGAATCACATGAGAGAAAAGTTCCAGCCAAAGTACCTGAAAAGAAA
GCACCACCACCTCCTAAAGTTATAAAGAAGCCAGTAATTGAAAAAATTGAAAAGACTTCT
CGAAGAATGGAGGAAGAAAAAGTTCAAGTCACCAAAGTACCTGAAGTTTCAAAGAAGATT
GTTCCACAAAAACCTTCCCGGACTCCAGTACAGGAAGAAGTTATTGAAGTGAAAGTACCA
GCTGTGCATACAAAGAAGATGGTTATTTCAGAAGAAAAGATGTTCTTTGCTTCTCACACA
GAGGAGGAGGTGTCAGTCACAGTCCCCGAGGTACAAAAGGAAATTGTTACTGAAGAGAAA
ATTCACGTTGCCGTTTCCAAAAGGGTTGAACCACCACCTAAAGTCCCTGAGCTACCTGAG
AAACCAGCTCCAGAAGAAGTGGCCCCTGTTCCTATCCCTAAAAAAGTGGAGCCCCCAGCA
CCAAAAGTTCCTGAGGTTCCCAAGAAACCCGTGCCAGAGGAGAAAAAGCCAGTTCCTGTG
CCTAAGAAGGAACCTGCTGCTCCCCCAAAAGTCCCAGAGGTGCCAAAGAAACCTGTCCCT
GAAGAAAAGATTCCCGTTCCTGTTGCAAAGAAAAAGGAAGCTCCCCCAGCTAAAGTTCCT
GAAGTACAGAAGAGAGTTGTGACAGAAGAAAAAATAACCATTGTAACTCAAAGAGAGGAA
TCTCCACCACCAGCAGTGCCAGAAATACCAAAGAAGAAAGTTCCTGAAGAAAGGAAACCT
GTTCCTCGGAAGGAGGAAGAAGTTCCACCACCACCAAAAGTGCCAGCTCTGCCTAAGAAA
CCCGTCCCAGAGGAGAAAGTTGCAGTGCCAGTTCCTGTCGCTAAGAAAGCTCCTCCTCCC
CGAGCTGAAGTCTCTAAGAAAACTGTTGTAGAAGAAAAGAGATTTGTTGCTGAAGAAAAA
CTATCCTTCGCAGTTCCTCAAAGAGTGGAAGTCACGCGGCACGAAGTATCTGCAGAGGAG
GAATGGAGTTACTCAGAAGAGGAGGAAGGTGTGTCCATTTCAGTTTATAGAGAAGAAGAA
AGAGAGGAGGAGGAAGAAGCAGAGGTTACAGAATATGAAGTGATGGAAGAGCCTGAGGAA
TATGTTGTGGAAGAAAAGCTGCACATTATTTCTAAGAGAGTGGAAGCTGAGCCAGCTGAA
GTGACAGAGAGGCAGGAGAAGAAAATTGTACTGAAACCAAAAATTCCTGCTAAAATAGAG
GAGCCTCCACCGGCTAAAGTTCCTGAAGCACCTAAGAAAATTGTGCCAGAAAAGAAAGTT
CCTGCTCCAGTTCCTAAAAAGGAAAAGGTGCCCCCACCTAAAGTGCCAGAAGAGCCAAAG
AAACCAGTTCCAGAAAAAAAGGTTCCTCCAAAAGTCATTAAGATGGAAGAACCTCTCCCA
GCCAAAGTGACTGAGAGGCACATGCAAATTACCCAGGAAGAAAAAGTTCTTGTTGCTGTA
ACTAAAAAAGAGGCGCCTCCAAAAGCAAGAGTGCCAGAGGAACCGAAGAGAGCTGTCCCA
GAAGAAAAAGTTCTGAAACTCAAACCTAAAAGAGAGGAGGAACCACCAGCTAAAGTGACT
GAATTCAGAAAAAGAGTGGTTAAAGAAGAAAAAGTATCAATTGAAGCTCCAAAAAGAGAA
CCTCAACCCATCAAAGAAGTAACTATAATGGAAGAGAAAGAAAGGGCTTATACCCTAGAA
GAAGAAGCTGTTTCAGTACAACGGGAAGAAGAATATGAGGAATATGAAGAATATGATTAT
AAAGAATTTGAGGAGTATGAACCAACAGAAGAATATGACCAATATGAAGAATACGAGGAG
CGGGAGTATGAACGATATGAAGAGCATGAAGAATACATCACAGAACCAGAGAAGCCTATC
CCTGTAAAGCCTGTCCCAGAAGAACCAGTTCCCACAAAACCAAAGGCCCCACCGGCTAAA
GTGCTGAAGAAAGCTGTCCCTGAAGAAAAAGTACCAGTGCCCATTCCTAAGAAACTCAAA
CCTCCACCACCCAAAGTGCCTGAAGAACCAAAGAAAGTTTTTGAGGAAAAAATACGTATT
TCAATTACCAAACGTGAAAAAGAGCAGGTGACTGAACCCGCTGCTAAAGTGCCCATGAAG
CCCAAGAGGGTTGTCGCAGAAGAAAAAGTACCTGTCCCTAGAAAAGAAGTAGCACCACCT
GTTAGAGTGCCAGAAGTGCCTAAAGAACTTGAACCAGAAGAGGTTGCCTTTGAAGAGGAA
GTTGTAACCCATGTAGAAGAATATCTTGTAGAAGAAGAAGAAGAGTACATTCATGAAGAA
GAGGAGTTCATAACTGAGGAAGAAGTGGTGCCAGTGATACCAGTCAAAGTGCCTGAGGTA
CCCAGGAAACCTGTTCCAGAAGAGAAGAAACCTGTTCCTGTTCCCAAGAAGAAGGAAGCT
CCACCGGCAAAAGTGCCTGAGGTTCCTAAGAAGCCAGAGGAGAAAGTTCCTGTGCTTATT
CCTAAAAAGGAGAAGCCTCCGCCAGCAAAAGTTCCTGAAGTGCCCAAGAAACCTGTGCCA
GAGGAGAAAGTACCAGTACCAGTTCCTAAAAAGGTGGAAGCTCCACCTGCCAAAGTGCCA
GAGGTACCCAAGAAGCCTGTGCCTGAGAAGAAGGTGCCAGTTCCTGCTCCTAAGAAAGTG
GAGGCTCCACCTGCAAAAGTGCCAGAGGTGCCCAAGAAGCTCATCCCAGAAGAAAAGAAA
CCAACACCTGTTCCGAAAAAAGTGGAAGCACCACCACCCAAAGTGCCAAAGAAACGTGAA
CCAGTTCCAGTTCCTGTAGCTCTACCTCAGGAAGAGGAAGTTCTATTTGAAGAAGAAATT
GTTCCTGAAGAGGAAGTTCTACCTGAGGAAGAGGAAGTTCTACCTGAGGAAGAGGAAGTT
CTACCTGAAGAAGAGGAAGTTCTACCTGAAGAAGAGGAAATTCCACCTGAGGAAGAGGAA
GTTCCTCCCGAAGAAGAATATGTACCTGAGGAAGAAGAATTTGTACCTGAAGAAGAAGTC
CTTCCAGAAGTTAAACCTAAGGTGCCAGTACCTGCACCAGTGCCTGAAATTAAGAAGAAA
GTGACAGAGAAGAAAGTGGTCATTCCCAAGAAAGAGGAGGCTCCCCCTGCCAAAGTTCCT
GAGGTGCCTAAGAAGGTGGAAGAAAAACGAATCATTCTCCCTAAAGAAGAGGAAGTTCTA
CCAGTTGAAGTGACTGAGGAGCCTGAAGAAGAGCCTATTTCAGAAGAAGAAATCCCAGAA
GAACCACCTAGCATAGAGGAAGTTGAAGAGGTGGCACCACCTAGAGTGCCTGAAGTGATT
AAGAAAGCAGTACCTGAAGCACCTACTCCTGTTCCTAAAAAAGTGGAGGCACCACCAGCT
AAAGTGTCAAAGAAAATTCCTGAGGAAAAAGTACCTGTTCCTGTTCAGAAAAAAGAGGCA
CCCCCAGCCAAAGTGCCTGAAGTACCAAAGAAAGTCCCAGAAAAGAAAGTCCTTGTGCCT
AAAAAGGAAGCTGTTCCCCCAGCTAAAGGGAGAACTGTCCTTGAAGAAAAAGTATCAGTT
GCCTTCCGCCAAGAAGTAGTAGTAAAAGAAAGACTAGAATTAGAAGTAGTAGAAGCAGAA
GTGGAAGAAATTCCGGAAGAAGAAGAGTTCCATGAAGTTGAAGAATATTTTGAAGAAGGC
GAGTTTCATGAAGTAGAAGAATTCATCAAATTAGAACAACATAGAGTTGAAGAAGAACAC
AGAGTTGAAAAAGTTCATAGGGTAATAGAAGTTTTTGAGGCTGAAGAAGTGGAAGTATTT
GAAAAACCAAAAGCTCCACCTAAAGGGCCTGAGATATCTGAGAAAATCATCCCTCCAAAA
AAACCGCCCACTAAAGTTGTTCCTCGAAAAGAGCCACCAGCTAAAGTACCGGAGGTGCCT
AAGAAAATTGTGGTAGAAGAAAAAGTACGTGTTCCTGAAGAGCCCAGAGTTCCACCAACT
AAAGTGCCTGATGTGCTGCCACCGAAGGAAGTGGTCCCAGAAAAGAAAGTACCGGTGCCT
CCTGCCAAAAAGCCAGAAGCTCCACCTCCTAAAGTGCCTGAGGCTCCCAAAGAAGTTGTT
CCTGAAAAGAAAGTGCCAGTGCCTCCTCCTAAAAAGCCTGAAGTGCCACCCACAAAAGTC
CCAGAGGTGCCAAAGGCAGCTGTCCCAGAAAAGAAGGTGCCTGAAGCTATTCCTCCCAAA
CCGGAAAGTCCTCCCCCTGAAGTGCCAGAGGCTCCGAAAGAAGTTGTTCCTGAAAAGAAA
GTGCCAGCGGCTCCTCCTAAAAAGCCTGAAGTCACACCTGTTAAAGTGCCTGAGGCTCCC
AAAGAAGTTGTTCCTGAAAAGAAAGTGCCAGTGCCTCCTCCTAAAAAGCCTGAAGTGCCA
CCCACAAAAGTCCCAGAGGTGCCAAAGGTAGCTGTCCCAGAAAAGAAGGTGCCTGAAGCT
ATTCCTCCCAAACCGGAAAGTCCTCCCCCTGAAGTGTTCGAGGAGCCTGAGGAAGTTGCC
CTAGAAGAGCCTCCTGCTGAAGTTGTGGAAGAGCCAGAGCCAGCGGCGCCTCCACAAGTG
ACCGTACCACCTAAGAAACCTGTCCCAGAAAAGAAAGCACCTGCTGTCGTTGCCAAAAAA
CCTGAACTACCACCAGTGAAAGTGCCCGAGGTGCCCAAGGAGGTTGTTCCTGAAAAGAAG
GTGCCTCTGGTGGTTCCCAAAAAGCCAGAAGCCCCACCTGCTAAAGTGCCTGAAGTTCCA
AAAGAAGTTGTTCCAGAAAAGAAAGTAGCTGTTCCCAAAAAGCCAGAAGTCCCACCAGCA
AAAGTGCCAGAAGTGCCAAAGAAACCTGTCTTGGAAGAGAAACCAGCTGTTCCTGTTCCA
GAAAGAGCGGAGTCTCCTCCCCCAGAAGTATATGAAGAACCTGAGGAAATTGCTCCTGAA
GAGGAAATTGCTCCTGAAGAGGAAAAGCCAGTTCCTGTTGCAGAAGAGGAGGAACCAGAG
GTTCCACCTCCAGCAGTGCCTGAAGAGCCCAAGAAGATCATCCCAGAGAAGAAAGTTCCT
GTCATCAAAAAACCAGAAGCACCGCCTCCTAAAGAACCTGAACCTGAAAAGGTTATTGAG
AAGCCAAAACTCAAACCAAGACCCCCACCTCCTCCACCTGCTCCACCTAAGGAAGATGTG
AAGGAGAAAATATTCCAACTTAAAGCTATTCCAAAGAAGAAAGTTCCTGAAAAACCTCAG
GTTCCAGAAAAAGTGGAGCTTACACCTCTGAAAGTGCCTGGAGGTGAAAAGAAAGTTCGC
AAATTACTTCCGGAACGTAAACCTGAACCAAAGGAAGAAGTTGTTCTGAAAAGCGTTCTA
AGAAAAAGACCTGAAGAAGAAGAACCTAAAGTAGAACCTAAAAAACTAGAAAAAGTTAAA
AAACCTGCAGTACCAGAACCACCACCTCCAAAACCTGTTGAAGAGGTTGAAGTACCTACT
GTTACAAAAAGGGAAAGGAAGATTCCTGAACCAACAAAAGTGCCTGAAATCAAGCCAGCA
ATACCTCTCCCTGCACCTGAACCGAAACCAAAGCCCGAAGCAGAAGTGAAAACAATCAAA
CCACCTCCTGTGGAACCTGAACCAACCCCCATCGCTGCCCCAGTAACAGTGCCAGTGGTT
GGAAAGAAAGCAGAAGCCAAAGCACCTAAGGAAGAGGCTGCCAAGCCAAAAGGTCCTATC
AAAGGTGTACCCAAAAAGACTCCTTCACCAATAGAAGCCGAAAGGAGAAAGTTAAGGCCA
GGAAGTGGTGGAGAGAAACCTCCTGATGAAGCCCCGTTCACCTACCAGCTAAAGGCTGTG
CCACTGAAGTTTGTGAAAGAAATCAAAGACATCATCTTGACAGAATCAGAGTTCGTTGGC
TCTTCAGCAATCTTTGAATGTTTGGTCTCCCCTTCCACTGCAATTACAACCTGGATGAAA
GACGGTAGCAATATCCGTGAGAGTCCCAAGCACAGGTTTATTGCAGATGGTAAAGACAGA
AAGCTGCACATCATTGATGTTCAACTTTCCGATGCTGGTGAATACACCTGTGTTTTACGT
TTGGGAAACAAAGAAAAGACCTCCACGGCTAAACTTGTTGTAGAAGAACTTCCTGTGCGT
TTTGTAAAAACACTGGAAGAGGAAGTCACAGTGGTCAAAGGACAGCCATTGTACTTGAGC
TGCGAGTTAAACAAAGAGCGTGACGTGGTCTGGAGGAAGGATGGCAAGATTGTGGTGGAG
AAACCTGGCCGAATTGTGCCAGGCGTCATTGGCTTGATGCGGGCCCTGACCATCAACGAT
GCAGATGACACAGATGCTGGAACATACACAGTTACTGTGGAAAACGCCAACAACCTGGAG
TGTTCATCTTGCGTAAAAGTAGTAGAAGTCATTAGAGATTGGCTGGTGAAACCTATACGA
GACCAGCATGTGAAACCCAAGGGGACAGCTATTTTTGCCTGTGATATAGCAAAAGATACT
CCAAACATTAAGTGGTTCAAAGGATATGATGAAATCCCTGCGGAACCAAATGATAAGACT
GAAATACTGAGAGATGGAAATCATCTGTACCTCAAAATTAAGAATGCTATGCCAGAAGAT
ATTGCTGAGTATGCAGTGGAAATTGAAGGAAAAAGATACCCTGCAAAGCTGACACTTGGA
GAGCGTGAAGTTGAACTGCTTAAACCAATAGAGGACGTTACCATTTATGAGAAAGAAAGT
GCAAGCTTTGATGCAGAAATCTCAGAGGCAGACATTCCTGGACAATGGAAACTGAAAGGA
GAACTTCTAAGGCCCTCACCTACTTGTGAAATCAAAGCAGAAGGTGGAAAACGCTTCTTA
ACTTTGCGCAAAGTCAAACTGGACCAAGCTGGTGAAGTCCTCTACCAGGCCCTTAATGCA
ATTACAACTGCCATTTTGACAGTAAAAGAAATCGAACTTGACTTTGCTGTGCCCCTGAAG
GATGTCACTGTTCCAGAAAGGCGACAGGCTCGATTCGAATGTGTCCTCACCCGAGAGGCA
AATGTTATATGGTCCAAAGGACCTGATATAATTAAGTCATCTGACAAATTTGATATCATC
GCTGATGGAAAGAAACATATTCTTGTTATTAATGATTCTCAATTTGATGATGAAGGGGTC
TATACTGCTGAGGTGGAGGGCAAGAAGACCTCAGCTCGGTTGTTTGTCACAGGTATAAGA
CTGAAATTCATGTCACCTCTTGAAGATCAAACAGTAAAAGAAGGTGAAACAGCAACTTTT
GTTTGTGAACTTTCTCATGAAAAAATGCATGTAGTCTGGTTCAAAAATGATGCCAAACTC
CATACAAGCAGAACAGTACTCATCTCTTCTGAGGGCAAGACTCACAAATTGGAAATGAAA
GAAGTGACATTGGATGATATATCTCAGATAAAAGCTCAAGTCAAGGAGCTGAGCTCCACA
GCACAGCTGAAGGTCTTAGAGGCCGATCCCTACTTCACTGTGAAATTACATGACAAAACT
GCAGTGGAGAAGGATGAGATTACTTTGAAGTGTGAAGTGAGCAAAGATGTACCAGTGAAA
TGGTTCAAAGATGGTGAAGAGATTGTCCCTTCACCCAAATATTCTATCAAGGCAGATGGC
CTGCGCCGCATCTTAAAAATCAAAAAGGCGGACCTTAAAGATAAAGGCGAATATGTGTGT
GACTGTGGCACAGACAAGACCAAGGCAAATGTTACTGTTGAGGCTCGACTAATAAAAGTG
GAAAAGCCTCTGTACGGAGTAGAGGTGTTTGTTGGTGAAACAGCCCACTTTGAAATTGAA
CTTTCTGAACCTGATGTTCACGGCCAGTGGAAGCTGAAAGGACAGCCTTTGACAGCTTCC
CCTGACTGTGAAATCATTGAGGATGGAAAGAAGCATATTCTGATCCTTCATAACTGTCAG
CTGGGTATGACAGGAGAGGTTTCCTTCCAGGCTGCTAATGCCAAATCTGCAGCCAATCTG
AAAGTGAAAGAATTGCCTCTTATCTTCATCACACCTCTCAGTGATGTTAAAGTCTTCGAG
AAAGATGAGGCTAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGTTGGCTA
AAAGGAACCCAGGAAATCACAGGTGATGACAGATTTGAGCTTATAAAGGATGGCACTAAG
CATTCAATGGTGATCAAGTCAGCTGCTTTTGAAGATGAAGCAAAATACATGTTTGAAGCT
GAAGATAAGCACACAAGTGGCAAACTGATCATTGAAGGAATCCGGCTCAAATTCCTCACC
CCTCTCAAAGATGTAACTGCCAAAGAGAAGGAAAGTGCTGTATTTACTGTGGAGTTATCT
CATGATAACATCCGAGTTAAATGGTTCAAGAATGACCAGCGCCTACACACCACCAGGTCG
GTCTCAATGCAAGACGAAGGGAAAACTCATTCGATCACATTCAAAGACCTGTCTATTGAT
GACACCTCCCAAATTAGAGTAGAAGCTATGGGGATGAGTTCAGAAGCTAAACTCACTGTG
CTTGAGGGAGACCCATATTTTACAGGAAAACTTCAAGATTATACTGGTGTAGAGAAAGAT
GAAGTTATTCTACAGTGTGAAATTAGCAAAGCAGATGCACCAGTGAAATGGTTTAAGGAT
GGGAAGGAAATAAAGCCATCCAAAAATGCTGTTATTAAGGCAGATGGCAAGAAACGCATG
CTAATCCTAAAGAAAGCCTTGAAATCAGATATTGGACAGTACACCTGTGACTGTGGGACA
GATAAGACCTCAGGAAAACTTGACATTGAGGATCGGGAAATTAAACTGGTGCGACCCCTG
CACAGTGTGGAGGTGATGGAGACTGAGACAGCACGCTTTGAAACCGAAATCTCTGAAGAT
GATATCCACGCCAACTGGAAACTCAAGGGAGAGGCCCTACTCCAAACACCTGATTGTGAA
ATTAAGGAAGAAGGCAAAATACACTCCCTTGTTTTGCACAACTGTCGCCTGGACCAGACG
GGTGGGGTGGATTTCCAAGCTGCCAATGTTAAATCTAGTGCCCACCTCCGAGTTAAGCCA
CGAGTAATTGGTCTTCTGAGGCCTTTAAAGGATGTCACCGTGACTGCAGGGGAAACAGCC
ACCTTCGACTGCGAGCTCTCCTACGAAGATATCCCAGTGGAATGGTATCTCAAAGGGAAG
AAACTAGAGCCCAGCGATAAGGTGGTCCCACGTTCAGAAGGAAAAGTTCATACACTTACT
CTGAGGGATGTAAAGTTAGAAGATGCTGGGGAAGTCCAACTAACAGCAAAAGATTTCAAA
ACTCACGCCAACCTCTTTGTGAAAGAACCCCCAGTTGAATTCACTAAGCCTCTTGAGGAC
CAGACGGTCGAAGAGGGAGCCACTGCAGTGCTGGAGTGTGAAGTCTCCAGAGAAAATGCT
AAGGTGAAATGGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATTGTT
GCTGATGGCAGGGTCAGAAAACTTGTTATACATGACTGTACCCCAGAGGATATTAAAACA
TACACTTGTGATGCTAAGGATTTTAAGACTTCCTGTAACCTGAATGTCGTGCCTCCTCAT
GTGGAATTCTTAAGACCACTCACCGACCTTCAAGTTAGAGAAAAAGAAATGGCTCGATTT
GAGTGTGAACTTTCCCGAGAAAATGCTAAGGTTAAGTGGTTTAAAGATGGTGCTGAAATT
AAAAAGGGCAAAAAATATGACATCATATCCAAGGGAGCAGTGCGCATTCTTGTCATCAAC
AAATGTCTACTGGATGATGAAGCTGAATATTCCTGTGAAGTAAGGACAGCGAGAACTTCT
GGCATGCTGACAGTTCTGGAAGAAGAAGCTGTCTTTACCAAAAATCTTGCCAACATTGAA
GTTAGTGAAACAGACACTATAAAACTGGTTTGTGAAGTCTCCAAACCTGGCGCAGAAGTG
ATTTGGTATAAAGGGGATGAGGAGATCATTGAAACAGGAAGATATGAAATACTGACTGAA
GGACGGAAGAGAATCCTGGTCATTCAGAACGCTCACCTTGAGGATGCTGGCAACTACAAC
TGTCGACTCCCAAGCTCTCGAACCGATGGCAAAGTCAAAGTACATGAACTGGCTGCTGAA
TTTATCTCAAAGCCTCAAAACCTTGAAATACTTGAAGGAGAAAAGGCTGAATTTGTCTGC
TCTATATCAAAAGAAAGCTTTCCAGTCCAGTGGAAGAGGGATGATAAGACACTTGAATCT
GGAGATAAATATGACGTTATTGCTGATGGTAAAAAGAGGGTCCTAGTTGTGAAAGATGCC
ACATTACAAGATATGGGCACTTACGTTGTCATGGTAGGGGCCGCCAGAGCAGCAGCTCAC
TTGACAGTCATTGAAAAACTCAGGATCGTAGTTCCTCTTAAGGACACCCGGGTGAAGGAA
CAACAGGAAGTTGTCTTCAACTGTGAAGTCAATACTGAAGGTGCCAAAGCCAAATGGTTC
AGAAATGAAGAAGCTATATTTGATAGTTCAAAATACATCATTCTCCAAAAAGACCTAGTC
TACACCCTCAGAATTAGAGATGCACACTTAGATGACCAAGCCAACTATAATGTGTCTTTG
ACCAATCACAGAGGTGAAAATGTTAAAAGTGCAGCCAATCTAATAGTAGAAGAGGAAGAC
CTTAGGATTGTTGAGCCTCTTAAAGATATTGAAACAATGGAGAAGAAATCTGTCACATTC
TGGTGCAAGGTGAATCGTCTCAATGTAACACTGAAGTGGACCAAAAATGGTGAAGAAGTG
CCTTTTGACAACCGTGTCTCATACAGAGTTGATAAGTACAAGCACATGTTAACCATTAAA
GACTGTGGCTTCCCAGATGAAGGTGAATACATTGTCACTGCTGGACAAGATAAATCTGTT
GCTGAGCTTCTCATCATAGAAGCCCCGACAGAATTTGTGGAACACTTGGAAGATCAGACA
GTCACTGAGTTCGATGACGCTGTCTTCTCCTGCCAGCTCTCCAGAGAGAAAGCCAATGTA
AAATGGTACAGAAATGGGAGAGAAATCAAAGAAGGCAAAAAATACAAATTTGAAAAAGAT
GGAAGTATACACAGACTCATTATAAAAGATTGCAGGCTGGATGATGAGTGTGAATATGCT
TGCGGGGTAGAAGACAGGAAGTCTCGTGCTAGACTTTTTGTGGAAGAAATTCCTGTTGAG
ATCATCAGGCCTCCACAAGATATTCTTGAAGCCCCTGGTGCTGATGTTGTCTTTTTAGCA
GAACTCAATAAAGATAAGGTGGAAGTCCAATGGCTAAGAAATAACATGGTTGTTGTCCAG
GGTGATAAACACCAGATGATGAGTGAAGGAAAGATACATCGACTACAGATTTGTGATATT
AAGCCCCGTGACCAGGGTGAATACAGATTTATTGCCAAAGACAAAGAAGCCAGAGCTAAG
CTTGAACTGGCAGCTGCACCAAAAATCAAGACAGCTGACCAAGACCTTGTGGTTGATGTT
GGCAAGCCTCTGACAATGGTGGTGCCATATGATGCCTACCCCAAAGCAGAAGCTGAATGG
TTTAAAGAAAATGAACCTTTATCTACAAAAACCATTGATACTACGGCTGAACAAACTTCT
TTCAGAATTTTAGAAGCCAAGAAAGGAGACAAAGGGAGGTATAAAATTGTGCTTCAGAAC
AAACATGGAAAAGCAGAAGGATTCATCAATTTAAAAGTTATTGATGTTCCTGGGCCAGTA
CGTAACTTAGAAGTGACAGAAACATTTGATGGTGAAGTGAGCCTTGCTTGGGAAGAACCT
TTAACTGATGGTGGAAGCAAAATCATAGGTTACGTTGTTGAAAGACGTGACATTAAGAGA
AAGACCTGGGTTCTGGCCACAGACCGTGCAGAGAGTTGTGAGTTTACTGTCACTGGTCTA
CAGAAAGGAGGAGTTGAGTACCTATTCCGTGTGAGTGCAAGAAACAGAGTTGGCACTGGT
GAGCCAGTAGAAACTGACAATCCTGTAGAAGCAAGGAGTAAATATGATGTTCCAGGCCCT
CCTTTGAATGTAACCATCACTGATGTGAATCGATTTGGTGTCTCACTGACATGGGAACCA
CCAGAGTATGATGGAGGTGCTGAGATCACAAACTACGTCATTGAATTAAGAGACAAGACT
TCTATCAGGTGGGATACTGCCATGACTGTGAGAGCTGAAGACCTGTCTGCAACTGTTACT
GATGTGGTAGAAGGACAGGAGTACAGTTTCCGAGTGAGAGCCCAAAATCGAATTGGAGTT
GGAAAACCAAGTGCAGCCACACCCTTCGTCAAAGTTGCTGATCCAATTGAGAGACCAAGT
CCTCCTGTAAACCTAACTTCCTCAGATCAGACTCAGTCATCAGTTCAGCTCAAATGGGAA
CCTCCTCTGAAAGATGGAGGAAGCCCAATATTAGGCTATATAATTGAGCGATGCGAAGAA
GGAAAAGATAATTGGATTCGTTGCAATATGAAACTTGTCCCTGAACTGACTTACAAGGTT
ACCGGATTGGAAAAAGGAAATAAATATTTATATAGAGTATCTGCAGAAAATAAAGCTGGT
GTTTCAGATCCATCTGAAATTCTTGGTCCTCTCACCGCTGACGATGCATTTGTTGAACCA
ACAATGGATTTAAGTGCATTTAAAGATGGTCTGGAAGTTATTGTCCCAAATCCTATCACG
ATCCTGGTTCCAAGTACAGGCTATCCAAGGCCAACTGCAACCTGGTGTTTTGGAGATAAA
GTACTAGAAACAGGGGACCGGGTGAAAATGAAGACCTTGTCTGCCTATGCCGAACTTGTC
ATTTCTCCAAGTGAACGTTCAGACAAGGGCATTTATACACTGAAATTAGAAAACCGTGTG
AAAACAATTTCTGGGGAAATTGATGTCAATGTAATTGCTCGCCCAAGTGCACCCAAAGAA
TTGAAATTTGGTGATATAACCAAGGACTCAGTACATTTGACTTGGGAACCACCTGATGAT
GATGGAGGAAGTCCGTTAACTGGATACGTTGTTGAAAAACGAGAAGTCAGCCGGAAAACA
TGGACTAAAGTTATGGACTTTGTGACTGATCTAGAATTCACAGTTCCTGATCTTGTTCAA
GGAAAAGAGTACTTATTTAAAGTTTGTGCTCGTAACAAATGTGGCCCTGGAGAACCTGCA
TATGTTGATGAACCTGTAAATATGTCAACTCCTGCAACGGTACCTGACCCACCAGAGAAT
GTTAAATGGAGAGATCGAACAGCCAATAGCATCTTCTTAACATGGGATCCACCTAAAAAT
GATGGTGGTTCACGCATCAAAGGATATATAGTTGAAAGATGTCCACGTGGTTCTGATAAA
TGGGTTGCCTGTGGAGAACCTGTTGCAGAAACAAAAATGGAAGTGACAGGTCTTGAGGAA
GGCAAATGGTATGCCTACCGCGTGAAGGCCTTAAACAGGCAGGGTGCTAGCAAACCAAGC
AGACCCACAGAGGAAATCCAGGCTGTGGACACACAAGAGGCCCCAGAAATCTTCCTCGAT
GTGAAGCTCCTTGCTGGTCTCACTGTAAAAGCTGGGACCAAGATTGAACTTCCTGCCACC
GTAACCGGAAAACCTGAACCTAAAATAACTTGGACAAAGGCTGATATGATTCTGAAGCAG
GACAAAAGAATTACCATTGAAAATGTCCCTAAGAAATCCACAGTGACTATTGTTGATAGT
AAGAGAAGTGACACTGGCACATATATCATTGAGGCTGTGAATGTGTGTGGCCGGGCCACT
GCTGTGGTGGAAGTGAACGTCTTAGATAAACCCGGACCACCAGCTGCCTTTGACATCACA
GATGTAACCAATGAGTCATGTCTTCTAACATGGAACCCACCACGCGATGATGGTGGATCT
AAGATCACAAACTATGTTGTGGAGAGACGAGCAACTGATAGTGAAGTGTGGCACAAGCTC
TCATCCACCGTCAAGGATACAAACTTCAAGGCCACCAAATTAATCCCCAATAAAGAGTAC
ATCTTCAGAGTTGCTGCAGAAAACATGTATGGTGTTGGTGAACCAGTTCAGGCCTCTCCA
ATAACAGCCAAATATCAGTTTGATCCACCTGGTCCTCCAACTCGCCTAGAACCTTCTGAT
ATCACTAAAGACGCAGTGACTCTCACATGGTGTGAGCCAGATGATGATGGTGGCAGCCCA
ATCACAGGATACTGGGTTGAAAGACTGGATCCTGATACAGATAAATGGGTTAGATGCAAT
AAGATGCCAGTAAAGGACACAACATACAGAGTGAAAGGTCTCACTAATAAGAAAAAATAC
AGATTCCGTGTGTTGGCTGAAAATCTTGCTGGACCTGGAAAACCAAGCAAATCAACTGAA
CCAATCTTAATAAAGGATCCCATAGATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAA
GATGTAGGCAAAACATCAGTAAGGTTGAATTGGACAAAACCAGAACATGATGGAGGTGCA
AAGATTGAGTCTTATGTCATTGAAATGCTGAAGACTGGAACAGATGAGTGGGTCAGAGTG
GCGGAAGGGGTTCCCACCACTCAGCACTTGCTCCCAGGGCTCATGGAAGGACAGGAATAC
TCATTCCGAGTTAGAGCTGTGAATAAGGCTGGGGAAAGTGAACCCAGTGAACCCAGTGAC
CCTGTGCTTTGCCGGGAGAAGCTATATCCTCCATCACCACCACGCTGGCTTGAAGTTATT
AATATCACAAAAAATACAGCAGACCTAAAATGGACAGTTCCTGAGAAAGATGGAGGGTCC
CCCATCACCAACTACATTGTGGAAAAGAGAGACGTCAGGCGAAAAGGCTGGCAAACAGTG
GATACCACTGTCAAGGACACCAAGTGCACAGTCACCCCACTGACTGAGGGCTCTTTATAT
GTGTTCCGAGTTGCTGCAGAAAATGCTATAGGACAAAGCGACTACACCGAAATTGAGGAC
TCTGTGCTGGCCAAAGACACCTTTACCACTCCTGGACCACCCTACGCCCTGGCAGTGGTT
GATGTGACAAAACGACATGTTGACCTAAAGTGGGAGCCACCTAAAAATGATGGTGGAAGA
CCAATACAGAGATATGTCATTGAGAAGAAAGAAAGGTTAGGTACCCGTTGGGTGAAAGCT
GGAAAGACTGCAGGACCTGACTGTAACTTCAGAGTAACTGATGTCATCGAAGGAACAGAG
GTCCAGTTTCAGGTTCGGGCTGAAAATGAAGCTGGAGTTGGCCACCCAAGTGAACCCACA
GAAATCCTATCCATTGAAGATCCAACAAGTCCTCCCTCACCACCCCTTGACCTACATGTG
ACTGATGCTGGGAGAAAACACATTGCCATTGCTTGGAAGCCTCCAGAGAAAAATGGTGGA
AGTCCTATCATAGGATACCATGTTGAAATGTGTCCAGTAGGCACTGAGAAATGGATGAGA
GTTAATTCTCGCCCAATAAAGGACTTGAAATTCAAGGTTGAAGAAGGTGTTGTTCCTGAC
AAAGAATATGTCCTGAGAGTGAGAGCAGTCAATGCTATTGGTGTCAGCGAGCCATCTGAA
ATCTCTGAAAATGTGGTTGCCAAAGACCCAGACTGCAAGCCAACAATTGACCTGGAGACT
CATGACATTATTGTTATTGAAGGTGAAAAGTTAAGCATTCCTGTTCCCTTCAGAGCTGTC
CCAGTTCCAACTGTTAGTTGGCATAAAGATGGCAAAGAAGTTAAAGCAAGTGATAGATTA
ACAATGAAGAATGATCACATCTCTGCACACCTTGAAGTTCCCAAGAGTGTCCGTGCAGAT
GCCGGAATTTATACCATTACACTGGAGAATAAGCTCGGCTCAGCAACAGCCTCAATCAAT
GTCAAAGTCATAGGCCTACCTGGACCATGCAAAGATATTAAAGCAAGTGACATTACCAAG
AGTTCTTGTAAGTTAACTTGGGAACCTCCAGAATTTGATGGTGGAACCCCAATTCTTCAT
TATGTCCTGGAGCGCAGAGAAGCTGGGAGGAGAACATATATACCAGTCATGTCTGGTGAG
AACAAACTGTCATGGACTGTGAAGGATCTCATACCAAATGGTGAATACTTCTTCCGTGTT
AAAGCAGTCAACAAGGTTGGTGGAGGAGAATATATTGAACTGAAAAATCCAGTCATTGCT
CAAGATCCAAAGCAACCCCCTGATCCACCTGTAGATGTAGAGGTTCATAATCCTACAGCG
GAGGCAATGACTATTACATGGAAGCCACCTTTGTATGATGGAGGGAGCAAGATAATGGGC
TACATCATAGAGAAGATTGCTAAGGGTGAAGAAAGGTGGAAGAGATGCAATGAACACCTG
GTACCAATCCTGACCTATACAGCAAAAGGACTTGAAGAGGGGAAAGAGTACCAATTCCGT
GTGCGAGCAGAGAACGCCGCGGGTATTAGTGAACCTTCTCGGGCTACTCCTCCAACCAAA
GCTGTAGATCCCATTGATGCCCCCAAAGTCATTCTGAGAACAAGCCTAGAAGTGAAACGA
GGTGATGAAATAGCACTTGATGCAAGTATTTCTGGATCACCTTACCCAACTATTACATGG
ATAAAGGATGAAAATGTTATTGTACCAGAGGAAATTAAGAAGCGTGCAGCACCCTTGGTT
AGGAGAAGGAAGGGTGAAGTTCAAGAAGAAGAACCATTTGTCCTGCCTCTGACACAGCGT
TTGAGTATTGACAACAGCAAAAAGGGAGAATCTCAGCTACGCGTCCGAGATTCTCTCCGA
CCTGACCATGGTCTGTATATGATCAAAGTTGAAAATGACCACGGTATTGCAAAAGCTCCT
TGTACTGTCAGTGTGTTAGATACACCGGGACCACCAATCAACTTTGTATTTGAAGATATC
AGAAAGACCTCAGTCCTTTGTAAATGGGAACCACCCCTTGATGATGGTGGCAGTGAAATC
ATAAACTACACTTTGGAAAAGAAAGACAAGACAAAACCCGACTCAGAATGGATTGTTGTC
ACTTCAACACTTAGACATTGCAAATATTCAGTAACAAAACTGATTGAAGGAAAAGAGTAC
CTCTTCCGTGTAAGAGCTGAAAACAGATTTGGGCCAGGTCCACCATGTGTTTCAAAGCCA
CTTGTGGCTAAAGATCCATTTGGACCACCTGATGCACCAGATAAGCCCATTGTGGAAGAT
GTTACCAGCAACAGTATGCTAGTGAAATGGAATGAACCAAAAGATAATGGAAGCCCCATT
TTGGGTTACTGGCTTGAAAAACGTGAAGTTAACAGTACACATTGGTCTCGTGTCAACAAA
AGCCTTCTGAATGCCTTGAAAGCCAATGTAGATGGCTTATTAGAAGGACTCACCTATGTC
TTCAGAGTATGTGCTGAAAATGCAGCTGGACCTGGAAAGTTCAGTCCACCTTCAGATCCC
AAAACAGCACATGATCCAATCTCTCCTCCTGGGCCACCTATCCCAAGAGTCACTGACACA
AGCTCTACAACTATTGAACTAGAATGGGAACCCCCAGCTTTCAATGGTGGTGGGGAAATT
GTTGGCTATTTTGTTGATAAGCAGTTGGTTGGCACAAATGAATGGTCACGCTGCACAGAG
AAGATGATCAAGGTCCGTCAGTACACCGTCAAAGAAATCCGAGAGGGTGCTGATTACAAA
CTTCGGGTGAGTGCTGTCAATGCCGCAGGGGAAGGACCGCCTGGAGAAACACAACCTGTT
ACTGTGGCTGAACCACAAGAGCCTCCAGCTGTGGAACTGGATGTTTCTGTCAAGGGTGGA
ATACAAATAATGGCTGGGAAGACTCTTAGAATTCCAGCTGTGGTGACTGGTCGCCCTGTA
CCTACAAAAGTATGGACCAAAGAAGAAGGGGAGCTGGATAAAGACCGTGTTGTAATAGAC
AACGTTGGAACCAAATCTGAACTAATTATCAAGGATGCACTGCGAAAAGACCATGGCAGA
TATGTGATTACAGCTACAAATAGCTGTGGTTCCAAATTTGCAGCAGCCAGGGTAGAAGTT
TTTGATGTCCCTGGTCCAGTTCTTGACTTAAAACCTGTTGTAACAAACAGAAAAATGTGT
CTACTTAACTGGTCTGATCCAGAAGATGATGGAGGAAGTGAAATAACAGGCTTTATCATT
GAAAGAAAAGATGCCAAGATGCATACTTGGAGACAACCAATAGAGACTGAGAGATCTAAA
TGTGACATCACAGGTCTGCTTGAGGGACAAGAATATAAGTTCCGTGTTATTGCCAAGAAC
AAGTTTGGCTGTGGCCCTCCTGTTGAAATAGGACCAATTCTTGCAGTTGATCCACTAGGT
CCTCCAACATCTCCAGAGAGGCTCACATACACTGAAAGGACAAAGTCCACTATCACACTT
GACTGGAAAGAGCCCCGCAGTAATGGTGGCAGTCCCATCCAAGGATATATCATTGAAAAA
CGGCGTCATGACAAACCTGACTTTGAAAGAGTTAACAAGCGACTCTGCCCAACCACATCT
TTTCTGGTTGAAAATCTTGATGAACACCAAATGTATGAGTTCCGTGTCAAAGCTGTCAAT
GAAATTGGTGAAAGTGAACCATCCCTACCTCTTAATGTAGTCATACAAGATGATGAAGTG
CCTCCAACTATTAAGTTGCGTCTGAGTGTTCGAGGAGACACTATCAAAGTTAAGGCAGGA
GAGCCTGTCCACATCCCTGCAGATGTGACAGGCCTTCCAATGCCTAAGATTGAATGGTCC
AAAAATGAAACTGTAATTGAAAAACCCACTGATGCACTTCAGATAACCAAGGAAGAGGTA
TCCCGAAGTGAGGCAAAAACTGAGCTTAGCATTCCCAAAGCGGTCCGGGAGGACAAAGGC
ACTTACACAGTTACTGCTTCCAATCGCCTTGGCTCAGTGTTCCGAAATGTTCACGTTGAA
GTATATGACCGCCCATCCCCACCAAGAAATCTTGCTGTTACTGACATTAAAGCTGAATCT
TGCTACTTGACATGGGATGCCCCTCTTGATAATGGTGGCAGTGAAATCACCCATTATGTT
ATTGACAAACGTGATGCAAGTAGGAAGAAAGCAGAATGGGAGGAAGTCACCAACACTGCT
GTAGAGAAAAGATATGGGATCTGGAAACTTATCCCCAATGGTCAGTATGAGTTCCGAGTC
AGGGCAGTGAATAAATATGGAATCAGTGATGAGTGCAAATCAGATAAAGTAGTCATTCAA
GATCCTTATCGCCTTCCTGGACCTCCAGGAAAACCAAAAGTTTTGGCACGCACCAAAGGA
TCAATGCTAGTGAGCTGGACTCCTCCTTTGGACAATGGTGGCTCTCCAATTACTGGCTAC
TGGCTGGAGAAAAGAGAAGAGGGAAGTCCTTATTGGTCACGTGTTAGCCGAGCACCAATA
ACCAAAGTGGGATTGAAAGGCGTGGAATTTAATGTTCCTCGTTTGCTTGAAGGCGTTAAA
TACCAGTTCAGAGCCATGGCAATAAATGCTGCAGGAATTGGTCCTCCCAGTGAACCATCA
GATCCAGAGGTTGCAGGAGATCCCATATTTCCACCGGGGCCACCTTCTTGCCCAGAAGTT
AAAGATAAAACGAAGTCAAGCATCTCACTAGGATGGAAACCTCCAGCCAAAGATGGTGGC
AGCCCAATCAAAGGATACATTGTAGAAATGCAAGAAGAAGGTACTACTGACTGGAAAAGA
GTAAATGAACCAGACAAACTTATAACTACCTGTGAATGTGTGGTGCCTAATCTGAAAGAG
CTCAGGAAGTACAGATTCAGAGTGAAAGCTGTCAATGAAGCTGGTGAATCTGAACCAAGT
GATACAACTGGGGAGATCCCTGCCACTGATATTCAAGAGGAACCAGAAGTTTTCATTGAC
ATTGGAGCACAGGACTGTCTGGTTTGTAAAGCTGGCTCACAGATTAGGATTCCTGCTGTC
ATCAAGGGACGCCCAACACCAAAATCATCTTGGGAATTTGATGGAAAGGCAAAGAAAGCA
ATGAAGGATGGAGTTCATGACATACCCGAAGATGCACAGCTGGAGACTGCTGAAAACTCC
TCAGTAATTATTATTCCGGAGTGTAAACGATCTCATACAGGCAAATACAGCATCACAGCC
AAGAATAAAGCAGGACAAAAGACTGCAAATTGCAGAGTTAAAGTCATGGATGTACCAGGC
CCACCCAAAGATCTGAAAGTCAGTGATATCACAAGGGGTAGTTGCAGACTTTCATGGAAG
ATGCCAGACGACGATGGAGGAGACAGGATCAAAGGCTATGTTATTGAGAAGAGGACTATT
GATGGAAAAGCCTGGACCAAAGTCAATCCAGACTGTGGAAGCACCACATTTGTAGTGCCT
GATCTCCTCTCTGAACAGCAATATTTCTTCCGTGTGCGAGCAGAAAACCGTTTTGGTATT
GGCCCACCTGTGGAAACCATTCAGAGGACCACTGCCAGAGATCCGATATATCCTCCTGAT
CCTCCTATTAAACTCAAGATTGGCCTCATCACAAAGAACACAGTGCATCTGTCATGGAAA
CCCCCGAAGAATGATGGGGGCTCCCCTGTTACCCACTATATTGTTGAGTGCCTTGCATGG
GACCCTACTGGGACAAAGAAAGAAGCCTGGAGGCAGTGCAATAAGCGTGATGTGGAAGAA
CTGCAATTTACTGTTGAAGACCTAGTAGAAGGTGGGGAATATGAATTCCGAGTCAAAGCT
GTCAATGCTGCAGGAGTCAGCAAGCCTTCAGCCACTGTTGGGCCCTGTGACTGTCAAAGA
CCAGACATGCCACCATCAATTGATCTAAAAGAATTCATGGAGGTTGAAGAAGGAACCAAT
GTTAACATTGTGGCCAAAATTAAAGGTGTGCCATTCCCGACACTAACCTGGTTTAAAGCT
CCTCCAAAGAAGCCTGATAACAAAGAACCTGTTCTCTATGACACCCATGTCAACAAACTG
GTGGTAGATGATACTTGCACTTTAGTTATTCCGCAGTCTCGCAGGAGTGACACTGGCTTA
TATACCATCACAGCTGTAAATAATCTGGGAACAGCATCAAAGGAGATGAGACTGAATGTC
CTGGGTCGTCCTGGCCCTCCAGTGGGACCCATAAAATTTGAATCTGTTTCAGCAGATCAA
ATGACACTATCTTGGTTTCCACCTAAAGATGATGGTGGGTCTAAGATTACAAACTATGTA
ATTGAGAAAAGAGAAGCTAACAGGAAGACATGGGTCCATGTCTCCAGTGAACCTAAGGAG
TGCACGTACACGATTCCCAAATTGCTAGAAGGCCATGAATATGTATTCCGAATCATGGCC
CAGAATAAATATGGCATTGGAGAACCTCTTGACAGTGAACCTGAAACAGCAAGAAACCTC
TTCTCTGTCCCTGGAGCACCAGATAAACCAACAGTTAGCAGCGTGACTCGTAACTCCATG
ACTGTCAACTGGGAAGAGCCAGAATATGATGGAGGCTCTCCTGTGACAGGGTACTGGCTG
GAAATGAAAGACACCACTTCAAAGAGATGGAAGAGAGTTAACCGAGATCCTATCAAAGCC
ATGACTTTGGGTGTTTCTTATAAAGTGACTGGTCTTATTGAAGGTTCCGACTATCAATTC
CGGGTATATGCAATCAATGCTGCTGGCGTGGGTCCAGCAAGTCTGCCATCAGACCCAGCG
ACTGCTAGAGATCCAATTGCCCCTCCTGGTCCTCCATTTCCCAAAGTGACAGATTGGACT
AAATCATCTGCAGATCTGGAGTGGTCTCCCCCACTAAAAGATGGTGGATCCAAAGTAACT
GGATACATCGTTGAATATAAAGAAGAAGGAAAAGAAGAATGGGAAAAGGGTAAAGATAAA
GAAGTGAGAGGAACAAAGCTCGTTGTGACAGGATTAAAGGAAGGAGCATTCTACAAATTT
AGAGTTAGTGCAGTCAACATTGCTGGCATTGGAGAACCTGGAGAGGTCACAGATGTCATT
GAAATGAAGGACAGACTTGTTTCACCTGACCTTCAGCTAGATGCCAGTGTCAGAGATAGA
ATTGTTGTCCATGCTGGAGGGGTGATCCGAATCATTGCCTATGTGTCTGGAAAGCCTCCT
CCAACCGTCACCTGGAACATGAATGAAAGAACCTTACCTCAAGAAGCCACCATTGAGACC
ACAGCCATTAGCTCATCCATGGTCATCAAGAACTGCCAGAGGAGCCATCAAGGCGTCTAT
TCTCTTCTTGCCAAAAATGAAGCCGGAGAAAGAAAGAAGACAATTATTGTTGATGTATTA
GATGTTCCAGGTCCCGTTGGAACACCATTCCTAGCTCACAACCTAACCAATGAGTCCTGC
AAACTGACATGGTTTTCTCCAGAAGATGATGGAGGCTCTCCAATCACCAATTATGTCATT
GAAAAGCGTGAATCTGACCGCAGAGCATGGACCCCAGTGACATATACAGTTACCCGACAA
AATGCTACTGTCCAGGGTCTCATTCAAGGAAAAGCCTACTTTTTCCGAATTGCGGCTGAA
AATAGTATTGGCATGGGTCCATTTGTTGAGACATCAGAGGCACTTGTTATCAGAGAGCCA
ATAACTGTACCAGAGCGTCCTGAAGACCTGGAAGTCAAAGAAGTTACTAAAAATACTGTA
ACTTTGACTTGGAATCCTCCTAAGTATGATGGTGGGTCAGAAATTATTAACTATGTCCTA
GAAAGTCGGCTCATTGGGACTGAGAAGTTCCACAAAGTTACAAATGACAACTTGCTTAGC
AGAAAATACACTGTTAAAGGCTTAAAAGAAGGTGATACCTATGAGTACCGTGTCAGTGCT
GTCAACATTGTTGGACAAGGCAAACCATCATTTTGCACCAAACCAATTACTTGCAAGGAT
GAGCTGGCACCCCCAACGCTTCACCTCGACTTCAGAGATAAGCTCACGATTCGAGTTGGT
GAAGCTTTTGCCCTCACTGGCCGTTACTCAGGCAAACCAAAGCCTAAGGTTTCCTGGTTC
AAAGATGAAGCTGATGTGCTGGAAGATGATCGCACTCATATAAAGACTACACCAGCAACA
CTTGCTTTAGAGAAGATCAAGGCCAAACGTTCAGATTCCGGCAAATACTGTGTGGTTGTG
GAGAACAGTACAGGCTCTAGGAAAGGTTTCTGTCAAGTTAATGTTGTTGACCGTCCTGGA
CCACCAGTAGGACCAGTTAGTTTTGATGAGGTGACCAAAGATTACATGGTTATCTCTTGG
AAGCCTCCTTTAGATGATGGAGGCAGTAAAATCACCAATTATATTATTGAGAAGAAGGAA
GTGGGTAAAGACGTCTGGATGCCAGTGACATCTGCAAGTGCTAAAACAACATGCAAAGTT
TCTAAACTACTTGAAGGAAAAGATTATATTTTCCGGATACATGCTGAAAATCTGTATGGA
ATAAGTGATCCTCTGGTGTCTGATTCAATGAAAGCCAAAGATCGTTTCAGGGTTCCTGAT
GCACCTGATCAGCCAATTGTTACAGAAGTTACCAAAGACTCTGCATTAGTAACCTGGAAT
AAGCCACATGATGGAGGAAAACCCATCACAAACTACATCCTGGAAAAGAGAGAAACTATG
TCTAAACGATGGGCTAGAGTTACCAAAGATCCTATTCATCCATACACTAAATTTAGGGTT
CCTGATCTTCTAGAAGGATGTCAGTATGAATTCCGGGTTTCTGCAGAAAATGAAATTGGT
ATTGGAGATCCAAGCCCACCATCCAAACCAGTCTTTGCTAAAGATCCAATTGCTAAACCA
AGTCCACCTGTTAATCCTGAAGCAATAGATACAACATGCAATTCAGTCGATCTAACTTGG
CAGCCACCACGTCATGATGGTGGGAGCAAGATTCTGGGTTATATTGTTGAGTACCAGAAA
GTTGGAGATGAAGAGTGGAGAAGAGCCAATCACACCCCTGAGTCATGTCCTGAAACTAAA
TATAAAGTCACCGGTCTTCGGGACGGTCAAACCTATAAGTTTAGAGTGTTAGCAGTCAAT
GCAGCTGGTGAATCAGATCCAGCTCATGTTCCGGAGCCAGTCCTAGTAAAAGACAGGCTT
GAACCCCCTGAGTTGATTCTTGATGCCAACATGGCAAGAGAACAACACATTAAAGTTGGT
GATACTCTAAGACTTAGTGCCATCATCAAAGGAGTGCCATTCCCAAAAGTAACTTGGAAA
AAAGAAGACAGAGATGCTCCAACTAAAGCAAGAATTGATGTGACTCCAGTTGGTAGCAAG
CTTGAAATTCGTAATGCTGCCCATGAAGATGGTGGAATTTATTCTTTAACAGTGGAGAAT
CCAGCTGGTTCAAAAACTGTCTCAGTAAAAGTACTTGTATTAGATAAACCTGGGCCACCT
AGAGATCTGGAAGTCAGTGAAATTAGGAAAGATTCATGTTACCTTACTTGGAAAGAACCA
CTGGATGATGGTGGTTCTGTTATTACCAATTATGTGGTTGAGAGGAGAGATGTTGCCAGC
GCCCAGTGGTCACCTCTCTCAGCTACATCAAAGAAAAAGAGTCACTTCGCTAAGCATCTG
AATGAAGGCAACCAGTACCTCTTCCGAGTAGCTGCGGAGAACCAGTATGGACGTGGTCCT
TTTGTTGAAACACCAAAACCAATCAAGGCTTTGGATCCTCTCCATCCCCCAGGGCCACCC
AAGGACCTGCACCATGTAGATGTTGACAAGACTGAAGTCTCCCTAGTCTGGAATAAGCCG
GATCGTGATGGTGGTTCTCCAATCACTGGATATTTGGTAGAATATCAAGAAGAAGGCACC
CAGGACTGGATTAAATTTAAGACTGTGACAAACTTAGAGTGTGTGGTTACTGGACTACAA
CAAGGAAAGACCTATAGATTCCGTGTAAAAGCTGAAAACATTGTGGGTCTTGGTCTCCCT
GACACAACTATCCCGATAGAATGTCAAGAAAAACTAGTGCCTCCATCCGTGGAGCTAGAT
GTGAAATTAATTGAAGGTCTTGTGGTAAAGGCTGGAACCACAGTCAGATTCCCTGCTATT
ATAAGAGGTGTGCCTGTTCCTACTGCAAAGTGGACAACCGATGGGAGTGAGATTAAAACC
GATGAGCACTACACAGTTGAAACAGACAACTTCTCATCAGTACTTACCATTAAGAACTGC
TTAAGGAGAGACACTGGGGAATATCAAATCACAGTTTCCAATGCAGCCGGTAGCAAAACA
GTAGCCGTACATCTTACTGTTCTTGATGTTCCTGGGCCACCAACAGGTCCTATTAATATT
CTGGATGTTACTCCTGAACACATGACTATCTCATGGCAGCCACCTAAGGATGATGGAGGA
AGCCCTGTGATAAATTATATTGTTGAGAAACAAGATACAAGGAAAGACACGTGGGGTGTT
GTCTCTTCCGGAAGCAGTAAGACAAAGCTGAAAATCCCACATCTGCAGAAGGGCTGTGAA
TATGTTTTCCGAGTTAGAGCAGAGAATAAGATAGGTGTTGGTCCTCCCCTTGACTCCACA
CCTACTGTTGCTAAGCATAAATTTAGTCCTCCGTCTCCTCCTGGTAAACCAGTGGTTACT
GACATTACTGAAAATGCAGCAACAGTGTCTTGGACCCTGCCAAAATCTGATGGTGGCAGT
CCAATAACTGGCTACTATATGGAACGTCGAGAAGTAACTGGCAAATGGGTGAGGGTCAAC
AAAACACCTATCGCTGACCTGAAGTTCAGAGTGACTGGACTCTATGAAGGAAATACATAT
GAGTTTAGAGTTTTTGCTGAAAATCTTGCAGGACTAAGCAAACCATCCCCAAGTTCTGAT
CCAATAAAAGCTTGCCGGCCCATCAAACCACCTGGACCACCTATTAATCCTAAACTGAAA
GACAAGAGCAGAGAAACAGCTGATTTGGTGTGGACAAAGCCTCTCAGTGATGGTGGTAGC
CCCATTCTAGGATATGTAGTGGAATGTCAGAAACCTGGCACGGCACAATGGAACAGGATT
AATAAAGATGAACTCATTAGGCAATGTGCCTTTAGGGTACCTGGACTAATTGAAGGAAAT
GAGTACAGATTCCGTATAAAGGCAGCTAATATTGTAGGAGAGGGTGAGCCAAGAGAACTA
GCAGAATCTGTGATTGCAAAAGATATCCTTCATCCTCCAGAAGTAGAACTTGATGTTACT
TGTCGTGATGTTATTACCGTGAGAGTAGGCCAAACTATCCGCATTCTAGCTCGAGTCAAA
GGCAGACCTGAACCAGACATAACTTGGACTAAGGAAGGCAAAGTATTGGTCCGAGAAAAG
AGGGTGGACCTTATTCAGGATCTACCTCGTGTTGAGTTACAAATTAAAGAAGCTGTTAGA
GCTGATCATGGCAAGTATATCATCTCAGCTAAGAACAGCAGTGGACATGCCCAAGGTTCA
GCCATCGTTAACGTCCTTGACAGACCTGGGCCTTGCCAGAATTTGAAGGTTACCAATGTA
ACCAAAGAGAACTGTACAATTTCTTGGGAAAACCCACTAGATAATGGTGGCTCAGAAATA
ACAAACTTCATAGTAGAATATCGCAAACCAAACCAGAAAGGCTGGTCAATTGTTGCATCA
GATGTCACTAAACGATTAATCAAGGCCAACCTTTTAGCCAACAATGAATACTATTTCCGA
GTTTGTGCAGAGAATAAAGTAGGTGTTGGGCCAACCATCGAAACAAAAACTCCCATTCTG
GCTATTAACCCTATTGACAGACCAGGTGAGCCTGAAAACCTTCACATTGCAGATAAAGGA
AAGACATTTGTCTATCTAAAGTGGCGGAGGCCTGACTATGATGGTGGCAGTCCAAATCTG
TCATATCATGTTGAGAGAAGGCTTAAGGGCTCCGATGACTGGGAAAGAGTGCATAAAGGA
AGCATTAAAGAAACTCACTACATGGTTGACAGATGTGTTGAAAACCAGATTTATGAGTTC
AGAGTGCAAACAAAGAATGAAGGTGGGGAAAGTGACTGGGTGAAGACAGAGGAAGTTGTT
GTGAAAGAAGACTTACAAAAACCAGTACTTGATCTGAAATTAAGTGGGGTCCTAACTGTC
AAAGCAGGGGACACCATTAGGCTTGAGGCAGGGGTTAGAGGCAAACCATTCCCAGAAGTT
GCATGGACCAAGGACAAAGACGCTACAGACTTAACAAGATCACCAAGGGTCAAGATTGAT
ACCCGTGCTGATTCATCTAAATTTTCTCTTACTAAAGCAAAGCGAAGTGATGGGGGTAAA
TATGTAGTTACGGCAACTAACACGGCTGGCAGTTTTGTGGCCTATGCCACTGTCAATGTT
TTAGATAAGCCTGGTCCTGTGAGAAATCTGAAAATTGTTGATGTGTCCAGTGATAGGTGT
ACTGTTTGCTGGGATCCACCAGAAGATGATGGTGGCTGTGAAATCCAAAATTATATTCTA
GAAAAATGTGAGACAAAGCGAATGGTTTGGTCTACCTATTCTGCTACTGTCTTGACACCT
GGTACTACAGTAACACGTCTCATAGAAGGAAATGAATATATTTTCAGAGTCCGTGCAGAA
AATAAAATAGGCACAGGGCCTCCAACAGAAAGTAAACCAGTCATAGCCAAAACCAAGTAT
GATAAACCTGGTCGCCCTGATCCCCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACT
GTGGTTTGGAATCCACCTGAATATGATGGTGGAAAGTCTATAACTGGATACTTTTTGGAG
AAAAAGGAAAAGCATTCAACACGATGGGTCCCTGTCAACAAGAGTGCAATCCCTGAGAGA
CGTATGAAAGTACAGAATCTCCTCCCAGACCATGAATATCAGTTCCGTGTCAAGGCAGAA
AATGAAATTGGAATTGGAGAACCAAGCTTGCCTTCAAGACCGGTGGTGGCAAAAGACCCC
ATAGAGCCACCTGGTCCACCAACCAATTTCAGAGTGGTTGATACAACCAAACATTCCATA
ACTCTTGGGTGGGGAAAACCAGTCTATGATGGTGGTGCACCGATCATTGGATATGTTGTG
GAAATGAGACCAAAAATAGCAGATGCGTCTCCTGATGAAGGCTGGAAACGGTGTAATGCT
GCAGCACAGCTTGTACGCAAGGAATTCACTGTTACCAGCTTGGATGAAAACCAGGAATAT
GAGTTCAGGGTGTGTGCCCAAAACCAAGTTGGTATTGGGCGCCCTGCAGAGCTAAAGGAA
GCTATCAAACCTAAAGAAATACTAGAACCTCCGGAGATTGATTTGGATGCCAGCATGAGG
AAACTGGTCATAGTGAGAGCAGGATGCCCTATTCGTCTCTTTGCTATAGTGAGAGGACGA
CCAGCCCCTAAAGTCACTTGGCGAAAAGTTGGCATTGATAATGTGGTCAGAAAAGGACAA
GTTGATCTGGTTGACACTATGGCCTTCCTTGTCATCCCCAATTCTACCCGTGATGACTCA
GGAAAATATTCCTTAACACTTGTGAACCCAGCAGGAGAAAAGGCTGTATTCGTAAATGTC
AGAGTATTAGACACTCCTGGGCCTGTGTCTGATTTAAAAGTTTCAGATGTCACTAAAACA
TCATGCCATGTGTCCTGGGCCCCTCCTGAAAACGACGGTGGGAGCCAAGTGACACATTAT
ATCGTGGAGAAACGTGAGGCAGACAGAAAGACATGGTCGACCGTTACCCCAGAAGTTAAG
AAAACAAGCTTCCATGTAACCAATCTTGTCCCTGGGAATGAGTATTACTTCAGAGTAACT
GCTGTCAACGAATATGGCCCTGGCGTCCCAACAGATGTCCCAAAACCAGTGCTTGCATCA
GATCCTCTAAGTGAGCCGGATCCCCCAAGGAAATTAGAAGTGACTGAAATGACCAAGAAC
AGTGCCACCTTAGCCTGGTTACCTCCCCTACGTGATGGAGGTGCTAAAATCGATGGCTAC
ATCACTAGTTACAGAGAAGAAGAGCAGCCTGCAGATCGCTGGACAGAGTACTCAGTGGTA
AAAGATCTGAGCCTTGTTGTCACTGGCCTAAAGGAAGGAAAGAAATACAAATTTAGAGTA
GCGGCCAGAAATGCTGTTGGAGTCAGTTTGCCAAGAGAAGCTGAAGGAGTGTATGAAGCC
AAAGAACAACTGTTGCCACCAAAGATCCTTATGCCAGAGCAAATAACTATCAAAGCTGGG
AAAAAACTCCGAATTGAAGCCCATGTGTATGGAAAGCCTCATCCCACCTGTAAATGGAAA
AAAGGAGAAGATGAAGTTGTCACATCCAGCCACCTGGCAGTGCATAAAGCAGACAGCTCT
TCAATTCTGATCATAAAAGATGTGACTAGGAAAGACAGTGGTTACTACAGCCTCACAGCA
GAGAACAGTTCTGGGACAGACACTCAGAAAATCAAAGTTGTAGTCATGGATGCCCCCGGC
CCCCCTCAGCCTCCATTTGACATTTCTGATATAGACGCTGATGCTTGCTCCCTGTCATGG
CACATCCCTCTGGAGGACGGAGGCAGTAACATCACCAATTATATAGTGGAGAAGTGTGAT
GTAAGCCGAGGTGACTGGGTCACGGCTCTAGCTTCAGTCACAAAAACTTCCTGCAGGGTT
GGAAAGCTGATCCCAGGCCAGGAGTACATCTTCCGGGTCCGTGCTGAAAACCGATTTGGC
ATTTCAGAGCCTCTCACATCTCCAAAGATGGTTGCGCAGTTCCCATTTGGTGTTCCTAGT
GAACCAAAGAATGCACGAGTCACCAAAGTCAACAAGGACTGTATTTTTGTTGCTTGGGAC
AGACCAGATAGTGATGGAGGGAGCCCCATTATTGGTTATCTGATTGAACGCAAGGAAAGA
AACAGTTTGCTGTGGGTGAAAGCCAATGATACTCTTGTCCGGTCAACTGAATATCCTTGT
GCTGGCCTTGTAGAAGGTCTTGAGTATTCATTCAGAATCTATGCCCTAAACAAAGCTGGA
TCCAGCCCACCCAGCAAACCCACAGAATATGTAACTGCAAGAATGCCAGTTGATCCTCCT
GGGAAACCTGAGGTTATTGATGTCACCAAGAGTACTGTATCTCTGATCTGGGCTCGTCCA
AAGCATGATGGAGGCAGTAAAATTATTGGCTATTTCGTAGAAGCTTGCAAACTTCCTGGT
GATAAATGGGTACGGTGCAATACTGCACCTCACCAGATTCCCCAGGAAGAGTACACAGCT
ACTGGCCTAGAAGAGAAAGCTCAGTATCAATTTAGAGCTATTGCCAGGACCGCGGTAAAC
ATTAGCCCACCTTCTGAACCTTCTGATCCAGTGACTATCCTCGCAGAAAATGTCCCTCCC
AGGATAGACCTGAGTGTGGCTATGAAATCTTTGCTTACTGTGAAAGCTGGAACTAATGTC
TGCTTGGATGCTACTGTTTTTGGTAAACCGATGCCAACAGTTTCTTGGAAAAAAGATGGC
ACACTGCTAAAACCAGCAGAAGGCATAAAGATGGCCATGCAGCGGAATCTGTGCACCTTG
GAGCTATTCAGCGTGAACCGGAAGGACTCAGGAGACTATACCATTACTGCTGAAAATTCA
AGTGGTTCTAAATCAGCCACCATTAAGCTTAAAGTGTTAGATAAACCGGGTCCTCCAGCA
TCTGTTAAAATCAACAAAATGTATTCAGATCGTGCTATGCTTTCTTGGGAACCGCCTCTT
GAAGATGGAGGCTCAGAAATCACCAACTATATTGTTGACAAACGTGAAACAAGCAGGCCC
AACTGGGCTCAAGTCTCTGCAACTGTGCCTATCACCAGCTGCAGCGTGGAGAAACTTATA
GAGGGCCATGAGTATCAGTTCCGTATTTGTGCTGAAAATAAATATGGAGTAGGCGATCCA
GTCTTCACTGAACCAGCAATTGCCAAAAACCCATATGACCCACCAGGACGCTGTGATCCT
CCTGTTATTAGCAACATAACCAAAGATCACATGACAGTCAGCTGGAAGCCACCAGCAGAT
GATGGGGGCTCACCCATCACTGGCTATTTGCTTGAAAAGCGGGAAACCCAGGCTGTTAAC
TGGACTAAGGTCAACAGAAAACCTATTATAGAAAGAACATTAAAAGCAACAGGTCTTCAA
GAAGGTACCGAATATGAGTTCCGTGTTACAGCTATAAATAAAGCTGGACCAGGCAAACCC
AGTGACGCATCCAAGGCCGCTTATGCTCGGGACCCTCAGTATCCTCCTGCGCCACCGGCT
TTCCCTAAAGTATATGATACAACTCGCAGCTCTGTGAGTCTATCTTGGGGCAAGCCAGCC
TATGACGGCGGCAGCCCTATCATTGGTTATCTCGTTGAAGTAAAACGGGCTGACTCCGAT
AACTGGGTGAGGTGCAACTTACCACAGAATCTACAGAAAACCCGCTTTGAGGTTACTGGC
CTGATGGAAGACACACAATATCAATTCCGTGTGTATGCCGTTAATAAGATTGGATACAGT
GACCCCAGTGATGTGCCAGATAAACACTATCCCAAGGACATCTTAATTCCACCTGAGGGA
GAACTTGATGCGGACTTAAGGAAGACACTCATATTACGTGCTGGAGTTACTATGAGACTA
TATGTACCAGTAAAAGGACGCCCACCTCCAAAGATTACTTGGTCTAAACCAAATGTCAAT
CTAAGAGACAGGATTGGACTGGACATAAAGTCAACTGACTTTGACACTTTCTTGCGCTGT
GAAAATGTGAACAAATATGATGCAGGAAAATATATCTTAACCCTGGAGAACAGCTGTGGT
AAAAAGGAATATACCATTGTTGTGAAAGTGCTTGATACTCCTGGGCCACCTGTCAATGTG
ACTGTTAAGGAAATATCCAAAGACTCTGCTTATGTTACCTGGGAGCCTCCCATTATTGAT
GGCGGAAGCCCCATCATAAACTATGTGGTACAAAAACGTGATGCAGAGAGGAAATCCTGG
TCTACAGTGACAACTGAGTGCTCCAAAACAAGCTTCAGAGTAGCTAATTTGGAGGAGGGA
AAATCCTACTTCTTCCGAGTGTTTGCTGAAAATGAGTATGGCATTGGTGATCCCGGTGAA
ACTCGTGATGCTGTCAAAGCTTCCCAAACTCCTGGACCAGTTGTGGACCTGAAAGTGAGG
TCTGTATCTAAGTCATCCTGTAGCATTGGCTGGAAAAAGCCTCACAGTGATGGTGGAAGT
CGGATTATTGGATATGTAGTTGATTTCCTGACTGAAGAAAATAAGTGGCAACGAGTTATG
AAATCCTTAAGCCTACAGTACTCTGCAAAAGATTTGACTGAAGGGAAGGAATATACCTTC
AGAGTGAGTGCTGAGAATGAAAATGGAGAAGGAACCCCAAGCGAAATCACTGTTGTGGCA
AGGGATGATGTTGTGGCTCCTGATCTTGACTTAAAGGGTCTACCTGATTTGTGCTACTTG
GCTAAAGAAAACAGCAACTTCCGGCTTAAGATCCCCATAAAAGGCAAGCCAGCTCCATCA
GTCTCCTGGAAGAAAGGGGAAGATCCTCTAGCAACTGACACTAGAGTCAGTGTTGAGTCA
TCTGCGGTTAACACAACTCTTATAGTGTACGATTGCCAAAAATCTGATGCTGGAAAATAC
ACAATCACACTTAAGAATGTTGCTGGCACCAAGGAAGGAACTATCTCCATAAAGGTTGTT
GGCAAGCCTGGCATCCCCACTGGACCAATCAAATTTGATGAAGTCACAGCAGAAGCCATG
ACCTTAAAGTGGGCTCCTCCAAAGGATGATGGAGGTTCTGAAATCACCAACTATATCCTA
GAGAAGAGGGATTCTGTGAACAACAAGTGGGTGACGTGCGCCTCAGCTGTCCAGAAAACC
ACCTTTAGAGTAACCAGACTTCATGAGGGCATGGAATATACCTTCAGGGTCAGTGCCGAA
AATAAATATGGTGTAGGGGAAGGCCTGAAATCGGAGCCAATTGTTGCGAGACATCCATTT
GATGTGCCTGATGCTCCCCCACCTCCCAATATTGTGGATGTCAGACACGATTCAGTATCT
CTAACTTGGACTGACCCCAAGAAAACTGGTGGTTCTCCAATTACAGGGTATCATCTCGAG
TTCAAGGAAAGAAACAGCCTTTTGTGGAAGAGAGCTAACAAGACTCCGATAAGGATGAGA
GACTTTAAAGTGACAGGATTAACTGAAGGTCTTGAATATGAATTCCGAGTTATGGCAATC
AATTTAGCAGGTGTGGGCAAGCCAAGCCTACCATCAGAGCCTGTTGTGGCACTGGACCCA
ATTGATCCTCCTGGAAAACCTGAGGTTATTAACATAACAAGGAATTCAGTGACTCTCATT
TGGACTGAACCTAAATATGACGGTGGTCATAAGTTAACTGGATATATAGTGGAGAAGCGA
GATCTACCTTCGAAGTCTTGGATGAAAGCCAACCATGTTAATGTCCCAGAATGTGCCTTT
ACTGTAACTGACCTTGTTGAGGGTGGAAAATATGAATTCAGAATTAGAGCAAAGAATACA
GCAGGTGCTATCAGTGCTCCATCAGAAAGTACAGAAACCATTATTTGCAAGGATGAATAC
GAGGCACCAACAATTGTCCTTGATCCCACAATAAAAGATGGGCTAACAATTAAAGCAGGG
GATACCATTGTTTTGAATGCCATTAGCATTCTTGGCAAACCCCTTCCAAAATCAAGTTGG
TCCAAGGCAGGAAAAGACATTAGACCATCAGATATCACTCAGATAACTTCAACCCCAACA
TCTTCCATGCTTACTATCAAGTATGCCACTAGAAAAGATGCGGGTGAATATACCATCACT
GCTACCAATCCTTTTGGCACGAAGGTGGAACATGTGAAGGTAACAGTCCTTGATGTACCT
GGTCCCCCAGGTCCTGTTGAAATCAGTAATGTTTCTGCTGAAAAAGCAACACTTACATGG
ACACCTCCCTTGGAAGATGGCGGCTCACCAATTAAGTCCTATATACTTGAAAAGAGAGAA
ACCAGCCGACTTTTGTGGACAGTGGTTTCTGAAGATATTCAGTCTTGCAGGCATGTGGCA
ACCAAACTTATCCAAGGAAATGAGTACATCTTCCGGGTCTCAGCTGTAAACCACTATGGC
AAAGGAGAACCTGTACAGTCTGAACCTGTCAAAATGGTAGACAGATTTGGTCCCCCTGGC
CCTCCTGAAAAACCAGAGGTATCAAATGTCACTAAGAACACTGCCACTGTCAGCTGGAAA
AGGCCAGTGGATGATGGTGGCAGCGAAATTACAGGATATCATGTAGAAAGGAGAGAAAAG
AAAAGCCTGCGATGGGTGAGAGCAATAAAAACACCAGTTTCCGATCTCAGGTGCAAAGTA
ACAGGACTGCAAGAAGGAAGCACCTACGAATTCCGTGTCAGTGCAGAAAACAGAGCAGGA
ATTGGTCCACCCAGTGAGGCTTCAGATTCTGTTCTGATGAAAGATGCAGCATATCCTCCA
GGACCACCTTCAAATCCGCATGTCACTGATACTACCAAGAAATCTGCTTCTTTGGCATGG
GGCAAGCCTCATTATGATGGTGGACTTGAAATCACTGGCTATGTCGTGGAGCATCAAAAA
GTAGGAGACGAGGCCTGGATAAAAGATACCACAGGAACCGCCCTCAGAATCACTCAGTTC
GTTGTTCCTGATCTTCAGACTAAAGAAAAATACAACTTCAGAATCAGTGCCATCAACGAT
GCAGGTGTTGGGGAGCCAGCGGTGATTCCAGATGTTGAAATCGTAGAACGGGAGATGGCT
CCTGATTTTGAACTAGATGCCGAGCTTCGAAGAACACTTGTTGTTAGAGCAGGACTCAGT
ATTAGGATATTTGTGCCAATTAAAGGTCGTCCTGCTCCTGAAGTGACATGGACCAAAGAT
AACATCAACCTGAAAAACCGAGCCAACATTGAAAATACGGAATCATTTACTCTTCTGATT
ATCCCAGAATGTAACAGATATGATACCGGTAAATTTGTCATGACCATTGAAAACCCGGCT
GGGAAGAAAAGTGGCTTTGTGAACGTCAGAGTCTTGGACACGCCAGGCCCAGTCCTCAAC
CTGCGGCCTACAGACATCACAAAGGACAGTGTCACCCTGCACTGGGACCTCCCTCTGATA
GATGGAGGCTCACGTATAACAAACTACATTGTAGAGAAACGTGAAGCAACACGGAAATCT
TATTCCACAGCCACC
Protein Properties
Number of Residues 34350
Molecular Weight 3816158.8
Theoretical pI 6.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Titin
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPHRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV
VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS
EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK
IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA
VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP
GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT
DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA
TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK
EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV
TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE
AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA
APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK
LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP
KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY
RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLP
KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY
VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG
RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE
KLKNVNIKEGSQLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST
VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF
RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK
RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR
VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY
RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE
SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI
DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR
VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT
KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG
RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI
EAHGKIYKLTVLNMMKDDEGKYTFYAGENITSGKLTVAGGAISKPLTDQTVAESQEAVFE
CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT
IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH
DTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE
TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF
RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR
MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY
KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ
PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN
AVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINET
LELLSESPVYSTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNG
VLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHK
DTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQ
LCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTD
TPCKAKSTPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHI
AKANELSSQLPLGAQELQSILEQDKLTPESTREFLCINGSIHFQPLKEPSPNLQLQIVQS
QKTFSKEGILMPEEPETQAVLSDTEKIFPSAMSIEQINSLTVEPLKTLLAEPEGNYPQSS
IEPPMHSYLTSVAEEVLSPKEKTVSDTNREQRVTLQKQEAQSALILSQSLAEGHVESLQS
PDVMISQVNYEPLVPSEHSCTEGGKILIESANPLENAGQDSAVRIEEGKSLRFPLALEEK
QVLLKEEHSDNVVMPPDQIIESKREPVAIKKVQEVQGRDLLSKESLLSGIPEEQRLNLKI
QICRALQAAVASEQPGLFSEWLRNIEKVEVEAVNITQEPRHIMCMYLVTSAKSVTEEVTI
IIEDVDPQMANLKMELRDALCAIIYEEIDILTAEGPRIQQGAKTSLQEEMDSFSGSQKVE
PITEPEVESKYLISTEEVSYFNVQSRVKYLDATPVTKGVASAVVSDEKQDESLKPSEEKE
ESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAKEVNW
YFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKR
AAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSL
EILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICT
VTGTPVIETIWQKDGAALSPSPNWKISDAENKHILELSNLTIQDRGVYSCKASNKFGADI
CQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKIC
FEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGE
SARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAV
NDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRS
SKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDL
IALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGK
YTCLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKD
GRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAP
FFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEII
RVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGST
PLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL
FVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVES
TAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL
AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGS
SICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIR
MTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQG
DPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEV
QNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQ
EISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEK
PQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKAT
DSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRV
SWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKE
PPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLH
ITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAG
SPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYA
FLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFEN
NVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSS
IHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSN
VAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSG
PKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASK
IVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGD
FICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKD
KRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFV
SKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKA
EPANAGKYICQIKNDGGMEENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPEL
SVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV
SDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDN
VCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFT
SVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ
ASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCN
IVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVG
DSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKA
ENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGV
LLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFF
DIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKV
GKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPE
IKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALT
VKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDT
SLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAI
VEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMR
ECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHI
TFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAI
LGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTC
VAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRE
LVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRL
ADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIED
YAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISW
YKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKERK
LPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATL
QILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKC
HVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKD
SCSAHLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFR
MSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKG
ADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKA
TNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIV
RESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPE
SIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDS
GVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISV
SWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVRE
PPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELE
LFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTG
TPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSA
QILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRN
NVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLP
VVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATN
PIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREI
RSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTK
RLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAG
MNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSE
PIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKV
TIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWR
QLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKI
EGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELL
KQSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDA
VFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGP
HIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTE
VEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATF
ECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG
EARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPE
EKKPPPKRIEVTKKAVKKDAKKVVAKPKEMTPREEIVKKPPPPTTLIPAKAPEIIDVSSK
AEEVKIMTITRKKEVQKEKEAVYEKKQAVHKEKRVFIESFEEPYDELEVEPYTEPFEQPY
YEEPDEDYEEIKVEAKKEVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEAYQEREVIQVQ
KEVYEESHERKVPAKVPEKKAPPPPKVIKKPVIEKIEKTSRRMEEEKVQVTKVPEVSKKI
VPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKEIVTEEK
IHVAVSKRVEPPPKVPELPEKPAPEEVAPVPIPKKVEPPAPKVPEVPKKPVPEEKKPVPV
PKKEPAAPPKVPEVPKKPVPEEKIPVPVAKKKEAPPAKVPEVQKRVVTEEKITIVTQREE
SPPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKVPALPKKPVPEEKVAVPVPVAKKAPPP
RAEVSKKTVVEEKRFVAEEKLSFAVPQRVEVTRHEVSAEEEWSYSEEEEGVSISVYREEE
REEEEEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQEKKIVLKPKIPAKIE
EPPPAKVPEAPKKIVPEKKVPAPVPKKEKVPPPKVPEEPKKPVPEKKVPPKVIKMEEPLP
AKVTERHMQITQEEKVLVAVTKKEAPPKARVPEEPKRAVPEEKVLKLKPKREEEPPAKVT
EFRKRVVKEEKVSIEAPKREPQPIKEVTIMEEKERAYTLEEEAVSVQREEEYEEYEEYDY
KEFEEYEPTEEYDQYEEYEEREYERYEEHEEYITEPEKPIPVKPVPEEPVPTKPKAPPAK
VLKKAVPEEKVPVPIPKKLKPPPPKVPEEPKKVFEEKIRISITKREKEQVTEPAAKVPMK
PKRVVAEEKVPVPRKEVAPPVRVPEVPKELEPEEVAFEEEVVTHVEEYLVEEEEEYIHEE
EEFITEEEVVPVIPVKVPEVPRKPVPEEKKPVPVPKKKEAPPAKVPEVPKKPEEKVPVLI
PKKEKPPPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVPVPAPKKV
EAPPAKVPEVPKKLIPEEKKPTPVPKKVEAPPPKVPKKREPVPVPVALPQEEEVLFEEEI
VPEEEVLPEEEEVLPEEEEVLPEEEEVLPEEEEIPPEEEEVPPEEEYVPEEEEFVPEEEV
LPEVKPKVPVPAPVPEIKKKVTEKKVVIPKKEEAPPAKVPEVPKKVEEKRIILPKEEEVL
PVEVTEEPEEEPISEEEIPEEPPSIEEVEEVAPPRVPEVIKKAVPEAPTPVPKKVEAPPA
KVSKKIPEEKVPVPVQKKEAPPAKVPEVPKKVPEKKVLVPKKEAVPPAKGRTVLEEKVSV
AFRQEVVVKERLELEVVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRVEEEH
RVEKVHRVIEVFEAEEVEVFEKPKAPPKGPEISEKIIPPKKPPTKVVPRKEPPAKVPEVP
KKIVVEEKVRVPEEPRVPPTKVPDVLPPKEVVPEKKVPVPPAKKPEAPPPKVPEAPKEVV
PEKKVPVPPPKKPEVPPTKVPEVPKAAVPEKKVPEAIPPKPESPPPEVPEAPKEVVPEKK
VPAAPPKKPEVTPVKVPEAPKEVVPEKKVPVPPPKKPEVPPTKVPEVPKVAVPEKKVPEA
IPPKPESPPPEVFEEPEEVALEEPPAEVVEEPEPAAPPQVTVPPKKPVPEKKAPAVVAKK
PELPPVKVPEVPKEVVPEKKVPLVVPKKPEAPPAKVPEVPKEVVPEKKVAVPKKPEVPPA
KVPEVPKKPVLEEKPAVPVPERAESPPPEVYEEPEEIAPEEEIAPEEEKPVPVAEEEEPE
VPPPAVPEEPKKIIPEKKVPVIKKPEAPPPKEPEPEKVIEKPKLKPRPPPPPPAPPKEDV
KEKIFQLKAIPKKKVPEKPQVPEKVELTPLKVPGGEKKVRKLLPERKPEPKEEVVLKSVL
RKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEIKPA
IPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPI
KGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVG
SSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLR
LGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVE
KPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR
DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPED
IAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKG
ELLRPSPTCEIKAEGGKRFLTLRKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLK
DVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGV
YTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL
HTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKT
AVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC
DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTAS
PDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFE
KDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEA
EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS
VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKD
EVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGT
DKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCE
IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA
TFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFK
THANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIV
ADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARF
ECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTS
GMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTE
GRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVC
SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH
LTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLV
YTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTF
WCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSV
AELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKD
GSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA
ELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK
LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTS
FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEP
LTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTG
EPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKT
SIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPS
PPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKV
TGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIT
ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRV
KTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT
WTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPEN
VKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEE
GKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPAT
VTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT
AVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKL
SSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLEPSD
ITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKY
RFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGA
KIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSD
PVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV
DTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVV
DVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTE
VQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGG
SPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSE
ISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRL
TMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITK
SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRV
KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG
YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK
AVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLV
RRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAP
CTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVV
TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVED
VTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV
FRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEI
VGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPV
TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVID
NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC
LLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKN
KFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEK
RRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV
PPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEV
SRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAES
CYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRV
RAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGY
WLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPS
DPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKR
VNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFID
IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENS
SVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWK
MPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGI
GPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAW
DPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQR
PDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKL
VVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQ
MTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMA
QNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWL
EMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPA
TARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK
EVRGTKLVVTGLKEGAFYKFRVSAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR
IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVY
SLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVI
EKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREP
ITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLS
RKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG
EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVV
ENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKE
VGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPD
APDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRV
PDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTW
QPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVN
AAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWK
KEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPP
RDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHL
NEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKP
DRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLP
DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKT
DEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINI
LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCE
YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGS
PITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD
PIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRI
NKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVT
CRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVR
ADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEI
TNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPIL
AINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKG
SIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTV
KAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGK
YVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYIL
EKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKY
DKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPER
RMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSI
TLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEY
EFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGR
PAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNV
RVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVK
KTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKN
SATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRV
AARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWK
KGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG
PPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRV
GKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWD
RPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAG
SSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPG
DKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPP
RIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTL
ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPL
EDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP
VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVN
WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPAPPA
FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTG
LMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRL
YVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCG
KKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSW
STVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVR
SVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKEYTF
RVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPS
VSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV
GKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKT
TFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVS
LTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAI
NLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKR
DLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEY
EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT
SSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTW
TPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYG
KGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREK
KSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP
GPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQF
VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLS
IRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPA
GKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS
YSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNI
MDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEY
TFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRP
KPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITI
QVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTV
IRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAVTKD
SMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRV
IAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIV
EKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCR
DDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIA
DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCV
LSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVN
KYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVER
RDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTV
FKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKA
TSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIR
ACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTV
ENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRES
TRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPG
KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQ
GEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIG
RPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETL
NVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSA
TVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSS
RDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEF
RVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGY
IVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAIT
ARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIK
STDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEK
CTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMA
VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVL
EKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD
PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGI
NKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN
IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTL
TLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKR
EATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP
PGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNL
TQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPI
SGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTA
SIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVV
SATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATA
ISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEY
EFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMIT
GYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGP
ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE
IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTS
EKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRI
MAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGY
IVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKA
CDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQT
GLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKG
IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKY
ILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVID
KRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPP
SPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVT
GLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEI
PVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA
TENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWH
MVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFV
TSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGL
EYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSK
ITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSS
GAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAA
RMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTG
VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYI
FRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEI
EGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVF
YRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCT
PPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADL
RKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDS
GRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNY
IVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVS
EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEA
TISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLK
IDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSA
GSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT
WHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTP
KVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDE
GLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGG
AKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSE
STGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEER
ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEIN
GLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEY
IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSE
ISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSP
LIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTS
IQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMR
KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSG
KYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYH
IEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE
KPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHV
VSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSN
LKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAAN
SSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETS
TAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPP
STPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTT
ISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAF
DGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISN
PSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL
QTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPI
EFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKG
NEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADG
GSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE
PSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEW
TTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDL
DVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQ
VTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDG
GSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCET
TEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAG
ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQV
TVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGK
YTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYS
IEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQ
FRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISG
REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITL
KWNPPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNA
VGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWF
KDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPG
KVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTA
IKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWA
RPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAA
GVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMC
KADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLT
APELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTL
TVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPL
LDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEP
YEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWV
EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGIT
NQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRG
DSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEI
TNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPII
AEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKV
PCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRS
TVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYE
FRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGG
KPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSV
MVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGE
CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGK
EHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQF
RVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDI
VGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIA
EIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAII
DTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDS
VTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLP
ENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEA
CKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLR
VLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKV
AKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISW
EPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG
IGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEV
RADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPP
GKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYT
LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGV
IRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKC
GKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKA
AWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPS
NPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTG
LVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEK
PECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGL
SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL
IQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP
LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQR
KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGS
WITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVS
SVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIS
VTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEE
LRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVT
DDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSG
KPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT
VELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ
ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETRE
VSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVK
KEISILNIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVH
QVCEALQFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEY
YAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKE
ISIEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKD
LNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIEN
YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY
AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI
TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE
DSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQ
PLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQ
EFKSKEEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKG
EFRLEIEEKKEERKLRMPYDVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKIRDQYEMP
GKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEIVRPARRRTPS
PDYDFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPP
HFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPTKAEASTSYAELRERHAQAAYRQPKQR
QRIMAEREDEELLRPVTTTQHLSEYKSELDFMSKEEKSRKKSRRQREVTEITEIEEEYEI
SKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSPTPER
TRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHA
PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI
LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA
YAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTR
KIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK
YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRV
KSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIA
KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEI
SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPV
IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHK
TDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEIS
QKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASE
EVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQT
LTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLF
TCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRG
QCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSAS
SMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEA
LPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDV
QKQDGGLYTLSLGNEFGSDSATVNIHIRSI
GenBank ID Protein 17066105
UniProtKB/Swiss-Prot ID Q8WZ42
UniProtKB/Swiss-Prot Entry Name TITIN_HUMAN
PDB IDs
GenBank Gene ID AJ277892
GeneCard ID TTN
GenAtlas ID TTN
HGNC ID HGNC:12403
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  5. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  8. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  9. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  10. Mayans O, van der Ven PF, Wilm M, Mues A, Young P, Furst DO, Wilmanns M, Gautel M: Structural basis for activation of the titin kinase domain during myofibrillogenesis. Nature. 1998 Oct 29;395(6705):863-9. [PubMed:9804419 ]
  11. Miller MK, Bang ML, Witt CC, Labeit D, Trombitas C, Watanabe K, Granzier H, McElhinny AS, Gregorio CC, Labeit S: The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response molecules. J Mol Biol. 2003 Nov 7;333(5):951-64. [PubMed:14583192 ]
  12. Bang ML, Centner T, Fornoff F, Geach AJ, Gotthardt M, McNabb M, Witt CC, Labeit D, Gregorio CC, Granzier H, Labeit S: The complete gene sequence of titin, expression of an unusual approximately 700-kDa titin isoform, and its interaction with obscurin identify a novel Z-line to I-band linking system. Circ Res. 2001 Nov 23;89(11):1065-72. [PubMed:11717165 ]
  13. Labeit S, Kolmerer B: Titins: giant proteins in charge of muscle ultrastructure and elasticity. Science. 1995 Oct 13;270(5234):293-6. [PubMed:7569978 ]
  14. Freiburg A, Trombitas K, Hell W, Cazorla O, Fougerousse F, Centner T, Kolmerer B, Witt C, Beckmann JS, Gregorio CC, Granzier H, Labeit S: Series of exon-skipping events in the elastic spring region of titin as the structural basis for myofibrillar elastic diversity. Circ Res. 2000 Jun 9;86(11):1114-21. [PubMed:10850961 ]
  15. Gautel M, Goulding D, Bullard B, Weber K, Furst DO: The central Z-disk region of titin is assembled from a novel repeat in variable copy numbers. J Cell Sci. 1996 Nov;109 ( Pt 11):2747-54. [PubMed:8937992 ]
  16. Musco G, Tziatzios C, Schuck P, Pastore A: Dissecting titin into its structural motifs: identification of an alpha-helix motif near the titin N-terminus. Biochemistry. 1995 Jan 17;34(2):553-61. [PubMed:7819249 ]
  17. Siu BL, Niimura H, Osborne JA, Fatkin D, MacRae C, Solomon S, Benson DW, Seidman JG, Seidman CE: Familial dilated cardiomyopathy locus maps to chromosome 2q31. Circulation. 1999 Mar 2;99(8):1022-6. [PubMed:10051295 ]
  18. Greaser ML, Berri M, Warren CM, Mozdziak PE: Species variations in cDNA sequence and exon splicing patterns in the extensible I-band region of cardiac titin: relation to passive tension. J Muscle Res Cell Motil. 2002;23(5-6):473-82. [PubMed:12785098 ]
  19. Gautel M, Lakey A, Barlow DP, Holmes Z, Scales S, Leonard K, Labeit S, Mygland A, Gilhus NE, Aarli JA: Titin antibodies in myasthenia gravis: identification of a major immunogenic region of titin. Neurology. 1993 Aug;43(8):1581-5. [PubMed:8351016 ]
  20. Labeit S, Gautel M, Lakey A, Trinick J: Towards a molecular understanding of titin. EMBO J. 1992 May;11(5):1711-6. [PubMed:1582406 ]
  21. Gautel M, Leonard K, Labeit S: Phosphorylation of KSP motifs in the C-terminal region of titin in differentiating myoblasts. EMBO J. 1993 Oct;12(10):3827-34. [PubMed:8404852 ]
  22. Mues A, van der Ven PF, Young P, Furst DO, Gautel M: Two immunoglobulin-like domains of the Z-disc portion of titin interact in a conformation-dependent way with telethonin. FEBS Lett. 1998 May 22;428(1-2):111-4. [PubMed:9645487 ]
  23. Ma K, Wang K: Interaction of nebulin SH3 domain with titin PEVK and myopalladin: implications for the signaling and assembly role of titin and nebulin. FEBS Lett. 2002 Dec 18;532(3):273-8. [PubMed:12482578 ]
  24. Lange S, Auerbach D, McLoughlin P, Perriard E, Schafer BW, Perriard JC, Ehler E: Subcellular targeting of metabolic enzymes to titin in heart muscle may be mediated by DRAL/FHL-2. J Cell Sci. 2002 Dec 15;115(Pt 24):4925-36. [PubMed:12432079 ]
  25. Kontrogianni-Konstantopoulos A, Bloch RJ: The hydrophilic domain of small ankyrin-1 interacts with the two N-terminal immunoglobulin domains of titin. J Biol Chem. 2003 Feb 7;278(6):3985-91. Epub 2002 Nov 19. [PubMed:12444090 ]
  26. Bullard B, Ferguson C, Minajeva A, Leake MC, Gautel M, Labeit D, Ding L, Labeit S, Horwitz J, Leonard KR, Linke WA: Association of the chaperone alphaB-crystallin with titin in heart muscle. J Biol Chem. 2004 Feb 27;279(9):7917-24. Epub 2003 Dec 4. [PubMed:14676215 ]
  27. Witt SH, Granzier H, Witt CC, Labeit S: MURF-1 and MURF-2 target a specific subset of myofibrillar proteins redundantly: towards understanding MURF-dependent muscle ubiquitination. J Mol Biol. 2005 Jul 22;350(4):713-22. [PubMed:15967462 ]
  28. Zastrow MS, Flaherty DB, Benian GM, Wilson KL: Nuclear titin interacts with A- and B-type lamins in vitro and in vivo. J Cell Sci. 2006 Jan 15;119(Pt 2):239-49. [PubMed:16410549 ]
  29. Hoshijima M: Mechanical stress-strain sensors embedded in cardiac cytoskeleton: Z disk, titin, and associated structures. Am J Physiol Heart Circ Physiol. 2006 Apr;290(4):H1313-25. [PubMed:16537787 ]
  30. Pfuhl M, Pastore A: Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set. Structure. 1995 Apr 15;3(4):391-401. [PubMed:7613868 ]
  31. Goll CM, Pastore A, Nilges M: The three-dimensional structure of a type I module from titin: a prototype of intracellular fibronectin type III domains. Structure. 1998 Oct 15;6(10):1291-302. [PubMed:9782056 ]
  32. Mayans O, Wuerges J, Canela S, Gautel M, Wilmanns M: Structural evidence for a possible role of reversible disulphide bridge formation in the elasticity of the muscle protein titin. Structure. 2001 Apr 4;9(4):331-40. [PubMed:11525170 ]
  33. Zou P, Pinotsis N, Lange S, Song YH, Popov A, Mavridis I, Mayans OM, Gautel M, Wilmanns M: Palindromic assembly of the giant muscle protein titin in the sarcomeric Z-disk. Nature. 2006 Jan 12;439(7073):229-33. [PubMed:16407954 ]
  34. Satoh M, Takahashi M, Sakamoto T, Hiroe M, Marumo F, Kimura A: Structural analysis of the titin gene in hypertrophic cardiomyopathy: identification of a novel disease gene. Biochem Biophys Res Commun. 1999 Aug 27;262(2):411-7. [PubMed:10462489 ]
  35. Hackman P, Vihola A, Haravuori H, Marchand S, Sarparanta J, De Seze J, Labeit S, Witt C, Peltonen L, Richard I, Udd B: Tibial muscular dystrophy is a titinopathy caused by mutations in TTN, the gene encoding the giant skeletal-muscle protein titin. Am J Hum Genet. 2002 Sep;71(3):492-500. Epub 2002 Jul 26. [PubMed:12145747 ]
  36. Itoh-Satoh M, Hayashi T, Nishi H, Koga Y, Arimura T, Koyanagi T, Takahashi M, Hohda S, Ueda K, Nouchi T, Hiroe M, Marumo F, Imaizumi T, Yasunami M, Kimura A: Titin mutations as the molecular basis for dilated cardiomyopathy. Biochem Biophys Res Commun. 2002 Feb 22;291(2):385-93. [PubMed:11846417 ]
  37. Gerull B, Gramlich M, Atherton J, McNabb M, Trombitas K, Sasse-Klaassen S, Seidman JG, Seidman C, Granzier H, Labeit S, Frenneaux M, Thierfelder L: Mutations of TTN, encoding the giant muscle filament titin, cause familial dilated cardiomyopathy. Nat Genet. 2002 Feb;30(2):201-4. Epub 2002 Jan 14. [PubMed:11788824 ]
  38. Van den Bergh PY, Bouquiaux O, Verellen C, Marchand S, Richard I, Hackman P, Udd B: Tibial muscular dystrophy in a Belgian family. Ann Neurol. 2003 Aug;54(2):248-51. [PubMed:12891679 ]
  39. Matsumoto Y, Hayashi T, Inagaki N, Takahashi M, Hiroi S, Nakamura T, Arimura T, Nakamura K, Ashizawa N, Yasunami M, Ohe T, Yano K, Kimura A: Functional analysis of titin/connectin N2-B mutations found in cardiomyopathy. J Muscle Res Cell Motil. 2005;26(6-8):367-74. [PubMed:16465475 ]
  40. Lange S, Xiang F, Yakovenko A, Vihola A, Hackman P, Rostkova E, Kristensen J, Brandmeier B, Franzen G, Hedberg B, Gunnarsson LG, Hughes SM, Marchand S, Sejersen T, Richard I, Edstrom L, Ehler E, Udd B, Gautel M: The kinase domain of titin controls muscle gene expression and protein turnover. Science. 2005 Jun 10;308(5728):1599-603. Epub 2005 Mar 31. [PubMed:15802564 ]
  41. Carmignac V, Salih MA, Quijano-Roy S, Marchand S, Al Rayess MM, Mukhtar MM, Urtizberea JA, Labeit S, Guicheney P, Leturcq F, Gautel M, Fardeau M, Campbell KP, Richard I, Estournet B, Ferreiro A: C-terminal titin deletions cause a novel early-onset myopathy with fatal cardiomyopathy. Ann Neurol. 2007 Apr;61(4):340-51. [PubMed:17444505 ]