You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08841
Secondary Accession Numbers
  • 14568
Name Telomerase-binding protein EST1A
Synonyms
  1. EST1-like protein A
  2. Ever shorter telomeres 1A
  3. Smg-6 homolog
  4. Telomerase subunit EST1A
  5. hSmg5/7a
Gene Name SMG6
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. May have a general role in telomere regulation. Promotes in vitro the ability of TERT to elongate telomeres. Overexpression induces telomere uncapping, chromosomal end-to-end fusions (telomeric DNA persists at the fusion points) and did not perturb TRF2 telomeric localization. Dephosphorylates RENT1. Plays a role in nonsense-mediated mRNA decay. May function as endonuclease. Degrades single-stranded RNA (ssRNA), but not ssDNA or dsRNA
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. nucleolus
  3. Chromosome
  4. telomere (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.3
SNPs SMG6
Gene Sequence
>4260 bp
ATGGCGGAAGGGCTGGAGCGTGTGCGGATCTCCGCGTCGGAGCTGCGCGGGATCCTGGCT
ACTCTGGCCCCGCAGGCCGGGAGCAGAGAAAACATGAAGGAATTAAAGGAGGCCAGGCCG
CGCAAAGATAACAGGCGTCCAGATCTGGAAATCTATAAGCCTGGCCTTTCTCGGCTAAGG
AACAAGCCCAAAATCAAGGAACCCCCTGGGAGTGAGGAATTCAAAGATGAAATTGTTAAT
GACCGAGATTGCTCTGCTGTTGAAAATGGTACACAGCCCGTTAAAGATGTCTGCAAGGAA
CTGAACAACCAAGAGCAGAATGGTCCTATAGACCCAGAAAATAATCGGGGACAAGAATCC
TTTCCTAGGACTGCTGGACAAGAGGATCGTAGTCTAAAAATTATCAAAAGAACAAAGAAA
CCCGACCTGCAGATCTATCAGCCTGGACGACGTTTGCAGACTGTTAGCAAAGAATCCGCC
AGTCGGGTGGAGGAGGAAGAAGTCCTCAACCAGGTAGAACAACTGAGAGTAGAGGAAGAT
GAGTGTAGGGGAAATGTTGCGAAGGAGGAAGTTGCGAATAAACCAGACAGGGCTGAGATA
GAAAAGAGCCCAGGTGGTGGGAGAGTAGGGGCTGCAAAAGGAGAAAAAGGAAAGAGGATG
GGAAAAGGGGAGGGGGTGAGGGAAACCCACGACGACCCAGCCCGCGGGAGGCCGGGCTCC
GCAAAGCGCTACTCCCGCTCAGACAAACGAAGGAATCGCTACCGCACGCGCAGCACCAGC
TCAGCTGGCAGCAACAACAGCGCTGAGGGAGCTGGCCTGACGGATAATGGATGTCGCCGC
CGCCGACAGGATAGGACCAAGGAGAGGCCACGACTGAAGAAGCAAGTGTCTGTGTCCTCA
ACCGATTCCTTAGACGAGGACAGAATTGATGAGCCTGATGGATTAGGACCCAGGAGAAGT
TCAGAAAGGAAGAGACATTTAGAAAGAAACTGGTCTGGCCGTGGGGAGGGTGAGCAGAAA
AACAGTGCTAAAGAATATCGAGGCACTCTTCGTGTCACTTTCGATGCAGAAGCCATGAAC
AAAGAGTCTCCCATGGTGAGGTCAGCCAGGGATGATATGGATAGAGGAAAGCCTGACAAA
GGCTTGAGCAGTGGGGGCAAAGGCTCTGAGAAGCAGGAGTCCAAAAACCCGAAACAAGAA
CTTCGGGGTCGTGGTCGTGGCATTCTGATTTTGCCTGCCCATACCACCCTATCTGTCAAT
TCAGCAGGTTCTCCAGAGTCCGCGCCTTTGGGACCTCGGCTTTTGTTTGGATCTGGTAGT
AAGGGATCTCGGAGTTGGGGCCGTGGAGGCACCACACGCCGATTGTGGGACCCAAACAAT
CCTGATCAGAAACCTGCTCTAAAGACTCAGACGCCCCAGCTACATTTCTTGGACACTGAT
GATGAAGTCAGCCCTACATCTTGGGGTGACTCACGCCAGGCTCAGGCATCTTACTATAAG
TTTCAAAACTCTGACAACCCCTATTATTACCCCCGGACACCAGGCCCTGCCTCCCAGTAT
CCCTATACGGGCTATAACCCTCTACAGTACCCAGTGGGCCCTACGAATGGTGTGTACCCA
GGGCCTTACTACCCAGGCTACCCGACTCCGTCAGGACAGTATGTGTGTAGCCCTCTACCT
ACCAGCACCATGAGTCCCGAGGAGGTAGAGCAGCACATGAGGAACCTGCAGCAACAGGAG
CTGCACAGGCTTCTCCGGGTGGCTGACAACCAGGAACTGCAGCTCAGCAACCTGCTCTCC
AGGGACCGCATCAGTCCGGAGGGCCTGGAGAAGATGGCGCAACTCAGAGCTGAACTGCTG
CAGCTATATGAGCGCTGTATTCTATTAGATATTGAGTTCTCTGATAATCAGAATGTGGAT
CAGATCCTGTGGAAGAATGCTTTCTATCAGGTGATTGAGAAGTTCAGGCAACTTGTCAAG
GATCCGAATGTTGAGAACCCAGAACAGATTCGGAACAGACTTTTGGAGCTCTTGGATGAG
GGTAGTGACTTCTTTGATAGTTTGCTTCAGAAGCTGCAGGTTACTTACAAGTTCAAACTG
GAAGACTACATGGATGGTCTTGCCATTCGCAGCAAGCCATTACGCAAGACAGTAAAATAT
GCCTTGATCAGTGCCCAGCGATGCATGATATGCCAAGGAGATATTGCTAGGTACCGGGAG
CAAGCCAGTGATACAGCGAATTATGGGAAAGCACGCAGTTGGTACCTGAAGGCCCAGCAC
ATTGCTCCCAAGAATGGGCGCCCCTATAACCAGTTGGCTTTGCTGGCAGTGTATACGAGG
AGGAAGCTTGACGCTGTCTATTACTATATGCGCAGTTTAGCTGCCAGCAACCCTATCCTG
ACTGCCAAGGAGAGTCTCATGAGCTTGTTTGAAGAGACCAAGCGGAAGGCAGAACAGATG
GAAAAGAAGCAACATGAGGAATTTGACCTGAGCCCTGACCAGTGGCGGAAAGGAAAGAAG
TCTACTTTCCGGCATGTTGGAGATGACACCACTCGCCTGGAGATCTGGATTCATCCATCC
CATCCACGGTCTTCCCAGGGCACTGAGTCTGGGAAGGATTCTGAGCAAGAGAATGGGCTG
GGCAGCCTGAGTCCCAGTGATCTGAACAAAAGGTTCATCCTCAGTTTTCTCCATGCCCAT
GGGAAGCTGTTTACCCGGATTGGGATGGAGACATTCCCTGCAGTGGCTGAGAAGGTCCTC
AAGGAGTTCCAGGTGTTACTGCAGCACAGCCCCTCTCCCATTGGAAGTACCCGCATGCTG
CAGCTTATGACCATCAATATGTTTGCAGTACACAACTCCCAGCTGAAAGACTGCTTCTCG
GAGGAGTGCCGCTCTGTGATCCAGGAACAAGCCGCAGCTCTGGGCTTGGCCATGTTTTCT
CTACTGGTCCGCCGCTGCACCTGCTTACTTAAGGAGTCCGCCAAAGCTCAGCTGTCCTCT
CCTGAGGACCAGGATGACCAAGACGACATCAAGGTGTCTTCCTTTGTCCCGGACCTGAAG
GAGCTGCTCCCCAGTGTCAAAGTCTGGTCAGATTGGATGCTCGGCTACCCGGACACCTGG
AATCCTCCTCCCACATCCCTGGATCTGCCCTCGCATGTTGCTGTGGATGTATGGTCGACG
CTGGCTGATTTCTGTAACATACTGACTGCAGTGAATCAGTCTGAGGTGCCACTGTACAAG
GACCCGGATGATGACCTCACCCTTCTTATCCTGGAAGAGGATCGGCTTCTCTCGGGCTTT
GTCCCCTTGCTGGCTGCCCCTCAGGACCCCTGCTACGTGGAGAAAACCTCGGATAAGGTT
ATTGCAGCTGACTGCAAAAGGGTCACAGTGCTGAAGTATTTTCTGGAAGCCCTTTGTGGA
CAAGAAGAGCCTCTGCTGGCATTCAAGGGTGGAAAGTATGTGTCAGTGGCACCCGTCCCA
GACACCATGGGAAAGGAAATGGGAAGCCAAGAGGGAACACGACTGGAAGATGAGGAGGAG
GATGTGGTGATTGAAGACTTTGAGGAAGATTCAGAGGCTGAAGGCAGCGGAGGCGAGGAT
GACATCAGGGAGCTTCGGGCCAAGAAGCTGGCTCTGGCCAGGAAGATAGCTGAGCAGCAG
CGTCGCCAGGAAAAGATCCAGGCTGTCCTGGAGGACCACAGTCAGATGAGGCAGATGGAG
CTCGAAATCAGACCTTTGTTCCTCGTACCAGACACCAACGGCTTCATTGACCACCTGGCC
AGTCTGGCGCGGCTGCTGGAGAGCAGGAAGTACATCCTGGTGGTGCCCCTCATCGTGATC
AATGAGCTGGACGGCCTGGCCAAGGGGCAGGAGACAGACCACCGGGCTGGGGGCTACGCC
CGTGTGGTACAAGAGAAGGCCCGCAAGTCCATCGAGTTCCTCGAGCAGCGATTCGAGAGT
CGGGACTCTTGCCTGCGAGCCCTGACCAGCCGTGGCAATGAACTCGAATCCATCGCCTTC
CGCAGTGAGGACATCACTGGCCAGCTGGGTAACAACGATGATCTCATCCTGTCCTGCTGC
CTCCACTACTGCAAAGACAAGGCTAAGGACTTCATGCCCGCCAGCAAAGAGGAGCCAATC
CGGCTACTGCGGGAGGTGGTGCTGTTGACGGATGACCGGAACCTGCGTGTGAAGGCGCTC
ACAAGGAATGTTCCTGTACGGGACATCCCAGCCTTCCTCACGTGGGCCCAGGTGGGCTGA
Protein Properties
Number of Residues 1419
Molecular Weight 160460.3
Theoretical pI 7.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Telomerase-binding protein EST1A
MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLR
NKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDPENNRGQES
FPRTAGQEDRSLKIIKRTKKPDLQIYQPGRRLQTVSKESASRVEEEEVLNQVEQLRVEED
ECRGNVAKEEVANKPDRAEIEKSPGGGRVGAAKGEKGKRMGKGEGVRETHDDPARGRPGS
AKRYSRSDKRRNRYRTRSTSSAGSNNSAEGAGLTDNGCRRRRQDRTKERPRLKKQVSVSS
TDSLDEDRIDEPDGLGPRRSSERKRHLERNWSGRGEGEQKNSAKEYRGTLRVTFDAEAMN
KESPMVRSARDDMDRGKPDKGLSSGGKGSEKQESKNPKQELRGRGRGILILPAHTTLSVN
SAGSPESAPLGPRLLFGSGSKGSRSWGRGGTTRRLWDPNNPDQKPALKTQTPQLHFLDTD
DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYP
GPYYPGYPTPSGQYVCSPLPTSTMSPEEVEQHMRNLQQQELHRLLRVADNQELQLSNLLS
RDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVK
DPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKY
ALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKK
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVHNSQLKDCFS
EECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLK
ELLPSVKVWSDWMLGYPDTWNPPPTSLDLPSHVAVDVWSTLADFCNILTAVNQSEVPLYK
DPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCG
QEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGED
DIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLA
SLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFES
RDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPI
RLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG
GenBank ID Protein 115511020
UniProtKB/Swiss-Prot ID Q86US8
UniProtKB/Swiss-Prot Entry Name EST1A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017575.4
GeneCard ID SMG6
GenAtlas ID SMG6
HGNC ID HGNC:17809
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  7. Venteicher AS, Abreu EB, Meng Z, McCann KE, Terns RM, Veenstra TD, Terns MP, Artandi SE: A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. Science. 2009 Jan 30;323(5914):644-8. doi: 10.1126/science.1165357. [PubMed:19179534 ]
  8. Reichenbach P, Hoss M, Azzalin CM, Nabholz M, Bucher P, Lingner J: A human homolog of yeast Est1 associates with telomerase and uncaps chromosome ends when overexpressed. Curr Biol. 2003 Apr 1;13(7):568-74. [PubMed:12676087 ]
  9. Snow BE, Erdmann N, Cruickshank J, Goldman H, Gill RM, Robinson MO, Harrington L: Functional conservation of the telomerase protein Est1p in humans. Curr Biol. 2003 Apr 15;13(8):698-704. [PubMed:12699629 ]
  10. Chiu SY, Serin G, Ohara O, Maquat LE: Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1. RNA. 2003 Jan;9(1):77-87. [PubMed:12554878 ]
  11. Glavan F, Behm-Ansmant I, Izaurralde E, Conti E: Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex. EMBO J. 2006 Nov 1;25(21):5117-25. Epub 2006 Oct 19. [PubMed:17053788 ]