Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08865
Secondary Accession Numbers
  • 14592
Name Nicotinamide riboside kinase 2
Synonyms
  1. Integrin beta-1-binding protein 3
  2. MIBP
  3. Muscle integrin-binding protein
  4. NRK 2
  5. Nicotinic acid riboside kinase 2
  6. NmR-K 2
  7. RNK 2
  8. Ribosylnicotinamide kinase 2
  9. Ribosylnicotinic acid kinase 2
Gene Name NMRK2
Protein Type Unknown
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). Reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin. Involved in the regulation of PXN at the protein level and of PXN tyrosine phosphorylation. May play a role in the regulation of terminal myogenesis.
Pathways
  • NAD(+) biosynthesis
  • Nicotinate and nicotinamide metabolism
Reactions
Adenosine triphosphate + Nicotinamide riboside → ADP + beta-nicotinamide D-ribonucleotide details
Adenosine triphosphate + Nicotinate D-ribonucleoside → ADP + nicotinate beta-D-ribonucleotide details
nicotinate beta-D-ribonucleotide + ADP → Nicotinate D-ribonucleoside + Adenosine triphosphate details
GO Classification
Biological Process
NAD biosynthetic process
negative regulation of myoblast differentiation
Cellular Component
intracellular
Molecular Function
metal ion binding
ATP binding
ribosylnicotinamide kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs ITGB1BP3
Gene Sequence
>693 bp
ATGAAGCTCATCGTGGGCATCGGAGGCATGACCAACGGCGGCAAGACCACGCTGACCAAC
AGCCTGCTCAGAGCCCTGCCCAACTGCTGCGTGATCCATCAGGATGACTTCTTCAAGCCC
CAAGACCAAATAGCAGTTGGGGAAGACGGCTTCAAACAGTGGGACGTGCTGGAGTCTCTG
GACATGGAGGCCATGCTGGACACCGTGCAGGCCTGGCTGAGCAGCCCGCAGAAGTTTGCC
CGTGCCCACGGGGTCAGCGTCCAGCCAGAGGCCTCGGACACCCACATCCTCCTCCTGGAA
GGCTTCCTGCTCTACAGCTACAAGCCCCTGGTGGACTTGTACAGCCGCCGGTACTTCCTG
ACCGTCCCGTATGAAGAGTGCAAGTGGAGGAGAAGTACCCGCAACTACACAGTCCCTGAT
CCCCCCGGCCTCTTCGATGGCCACGTGTGGCCCATGTACCAGAAGTATAGGCAGGAGATG
GAGGCCAACGGTGTGGAAGTGGTCTACCTGGACGGCATGAAGTCCCGAGAGGAGCTCTTC
CGTGAAGTCCTGGAAGACATTCAGAACTCGCTGCTGAACCGCTCCCAGGAATCAGCCCCC
TCCCCGGCTCGCCCAGCCAGGACACAGGGACCCGGACGCGGATGCGGCCACAGAACGGCC
AGGCCTGCAGCGTCCCAGCAGGACAGCATGTGA
Protein Properties
Number of Residues 230
Molecular Weight 26045.335
Theoretical pI 6.131
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Nicotinamide riboside kinase 2
MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESL
DMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYSRRYFL
TVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKSREELF
REVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
GenBank ID Protein 24762248
UniProtKB/Swiss-Prot ID Q9NPI5
UniProtKB/Swiss-Prot Entry Name NRK2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_170678.2
GeneCard ID ITGB1BP3
GenAtlas ID ITGB1BP3
HGNC ID HGNC:17871
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bieganowski P, Brenner C: Discoveries of nicotinamide riboside as a nutrient and conserved NRK genes establish a Preiss-Handler independent route to NAD+ in fungi and humans. Cell. 2004 May 14;117(4):495-502. [PubMed:15137942 ]
  4. Tempel W, Rabeh WM, Bogan KL, Belenky P, Wojcik M, Seidle HF, Nedyalkova L, Yang T, Sauve AA, Park HW, Brenner C: Nicotinamide riboside kinase structures reveal new pathways to NAD+. PLoS Biol. 2007 Oct 2;5(10):e263. [PubMed:17914902 ]
  5. Li J, Mayne R, Wu C: A novel muscle-specific beta 1 integrin binding protein (MIBP) that modulates myogenic differentiation. J Cell Biol. 1999 Dec 27;147(7):1391-8. [PubMed:10613898 ]
  6. Li J, Rao H, Burkin D, Kaufman SJ, Wu C: The muscle integrin binding protein (MIBP) interacts with alpha7beta1 integrin and regulates cell adhesion and laminin matrix deposition. Dev Biol. 2003 Sep 1;261(1):209-19. [PubMed:12941630 ]