You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08908
Secondary Accession Numbers
  • 14637
Name Dual specificity protein phosphatase 1
Synonyms
  1. Dual specificity protein phosphatase hVH1
  2. MAP kinase phosphatase 1
  3. MKP-1
  4. Mitogen-activated protein kinase phosphatase 1
  5. Protein-tyrosine phosphatase CL100
Gene Name DUSP1
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle (By similarity).
Pathways
  • MAPK signaling pathway
  • Serotonergic synapse
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
cell cycle
positive regulation of apoptotic process
cellular response to hormone stimulus
response to retinoic acid
response to light stimulus
response to calcium ion
response to oxidative stress
response to testosterone stimulus
response to glucocorticoid stimulus
regulation of apoptotic process
endoderm formation
response to estradiol stimulus
response to hydrogen peroxide
response to cAMP
intracellular signal transduction
Cellular Component
nucleoplasm
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/threonine phosphatase activity
non-membrane spanning protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 5
Locus 5q34
SNPs DUSP1
Gene Sequence
>1104 bp
ATGGTCATGGAAGTGGGCACCCTGGACGCTGGAGGCCTGCGGGCGCTGCTGGGGGAGCGA
GCGGCGCAATGCCTGCTGCTGGACTGCCGCTCCTTCTTCGCTTTCAACGCCGGCCACATC
GCCGGCTCTGTCAACGTGCGCTTCAGCACCATCGTGCGGCGCCGGGCCAAGGGCGCCATG
GGCCTGGAGCACATCGTGCCCAACGCCGAGCTCCGCGGCCGCCTGCTGGCCGGCGCCTAC
CACGCCGTGGTGTTGCTGGACGAGCGCAGCGCCGCCCTGGACGGCGCCAAGCGCGACGGC
ACCCTGGCCCTGGCGGCCGGCGCGCTCTGCCGCGAGGCGCGCGCCGCGCAAGTCTTCTTC
CTCAAAGGAGGATACGAAGCGTTTTCGGCTTCCTGCCCGGAGCTGTGCAGCAAACAGTCG
ACCCCCATGGGGCTCAGCCTTCCCCTGAGTACTAGCGTCCCTGACAGCGCGGAATCTGGG
TGCAGTTCCTGCAGTACCCCACTCTACGATCAGGGTGGCCCGGTGGAAATCCTGCCCTTT
CTGTACCTGGGCAGTGCGTATCACGCTTCCCGCAAGGACATGCTGGATGCCTTGGGCATA
ACTGCCTTGATCAACGTCTCAGCCAATTGTCCCAACCATTTTGAGGGTCACTACCAGTAC
AAGAGCATCCCTGTGGAGGACAACCACAAGGCAGACATCAGCTCCTGGTTCAACGAGGCC
ATTGACTTCATAGACTCCATCAAGAATGCTGGAGGAAGGGTGTTTGTCCACTGCCAGGCA
GGCATTTCCCGGTCAGCCACCATCTGCCTTGCTTACCTTATGAGGACTAATCGAGTCAAG
CTGGACGAGGCCTTTGAGTTTGTGAAGCAGAGGCGAAGCATCATCTCTCCCAACTTCAGC
TTCATGGGCCAGCTGCTGCAGTTTGAGTCCCAGGTGCTGGCTCCGCACTGTTCGGCAGAG
GCTGGGAGCCCCGCCATGGCTGTGCTCGACCGAGGCACCTCCACCACCACCGTGTTCAAC
TTCCCCGTCTCCATCCCTGTCCACTCCACGAACAGTGCGCTGAGCTACCTTCAGAGCCCC
ATTACGACCTCTCCCAGCTGCTGA
Protein Properties
Number of Residues 367
Molecular Weight 39297.37
Theoretical pI 7.195
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 1
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
GenBank ID Protein 18490273
UniProtKB/Swiss-Prot ID P28562
UniProtKB/Swiss-Prot Entry Name DUS1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC022463
GeneCard ID DUSP1
GenAtlas ID DUSP1
HGNC ID HGNC:3064
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Keyse SM, Emslie EA: Oxidative stress and heat shock induce a human gene encoding a protein-tyrosine phosphatase. Nature. 1992 Oct 15;359(6396):644-7. [PubMed:1406996 ]
  3. Kwak SP, Hakes DJ, Martell KJ, Dixon JE: Isolation and characterization of a human dual specificity protein-tyrosine phosphatase gene. J Biol Chem. 1994 Feb 4;269(5):3596-604. [PubMed:8106404 ]