Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08914
Secondary Accession Numbers
  • 14643
Name Dual specificity protein phosphatase 7
Synonyms
  1. Dual specificity protein phosphatase PYST2
Gene Name DUSP7
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Regulates the activity of the MAP kinase family in response to changes in the cellular environment. PYST2-S may act as a negative regulator of PYST2-L although it is unclear whether this is by competing for transcription, translation or activation factors.
Pathways
  • MAPK signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
innate immune response
MyD88-dependent toll-like receptor signaling pathway
stress-activated MAPK cascade
Toll signaling pathway
toll-like receptor 1 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
TRIF-dependent toll-like receptor signaling pathway
nerve growth factor receptor signaling pathway
peptidyl-tyrosine dephosphorylation
Cellular Component
cytosol
nucleoplasm
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 3
Locus 3p21
SNPs DUSP7
Gene Sequence
>1107 bp
ATGCCCTGCAAGAGCGCCGAGTGGCTGCAGGAGGAGCTGGAGGCGCGCGGCGGCGCGTCC
TTGCTGCTGCTCGACTGCCGGCCGCACGAGCTCTTCGAGTCGTCGCACATCGAGACGGCC
ATCAACCTGGCCATCCCGGGCCTCATGTTGCGCCGCCTGCGCAAGGGCAACCTGCCCATC
CGCTCCATCATCCCCAACCACGCCGACAAGGAGCGCTTCGCCACGCGCTGCAAGGCGGCC
ACCGTGCTGCTCTACGACGAGGCCACGGCCGAGTGGCAGCCCGAGCCCGGCGCTCCCGCC
TCCGTGCTCGGCCTGCTCCTACAGAAGCTGCGCGACGACGGCTGCCAGGCCTACTACCTC
CAAGGTGGTTTCAACAAGTTTCAAACAGAGTACTCTGAGCACTGCGAGACCAACGTGGAC
AGCTCTTCCTCGCCGAGCAGCTCGCCACCCACCTCAGTGCTGGGCCTGGGGGGCCTGCGC
ATCAGCTCTGACTGCTCCGACGGCGAGTCGGACCGAGAGCTGCCCAGCAGTGCCACCGAG
TCAGACGGCAGCCCTGTGCCATCCAGCCAACCAGCCTTCCCTGTCCAGATCCTGCCCTAC
CTCTACCTCGGCTGCGCCAAGGACTCCACCAACCTGGACGTGCTCGGCAAGTATGGCATC
AAGTATATCCTCAATGTCACACCCAACCTACCCAACGCCTTCGAGCACGGCGGCGAGTTC
ACCTACAAGCAGATCCCCATCTCTGACCACTGGAGCCAGAACCTCTCCCAGTTCTTCCCT
GAGGCCATCAGCTTCATTGACGAAGCCCGCTCCAAGAAGTGTGGTGTCCTGGTGCACTGC
CTGGCAGGCATCAGCCGCTCAGTGACGGTCACTGTGGCCTATCTGATGCAGAAGATGAAC
CTGTCACTCAACGACGCCTACGACTTTGTCAAGAGGAAAAAGTCCAACATCTCGCCCAAC
TTCAACTTCATGGGGCAGCTGCTGGACTTTGAGCGGACGCTGGGGCTAAGCAGCCCGTGC
GACAACCACGCGTCGAGTGAGCAGCTCTACTTTTCCACGCCCACCAACCACAACCTGTTC
CCACTCAATACGCTGGAGTCCACGTGA
Protein Properties
Number of Residues 368
Molecular Weight 44956.0
Theoretical pI 6.091
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 7
MPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPI
RSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYL
QGGFNKFQTEYSEHCETNVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDRELPSSATE
SDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEF
TYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMN
LSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLF
PLNTLEST
GenBank ID Protein 21779999
UniProtKB/Swiss-Prot ID Q16829
UniProtKB/Swiss-Prot Entry Name DUS7_HUMAN
PDB IDs Not Available
GenBank Gene ID AF508727
GeneCard ID DUSP7
GenAtlas ID DUSP7
HGNC ID HGNC:3073
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  3. Groom LA, Sneddon AA, Alessi DR, Dowd S, Keyse SM: Differential regulation of the MAP, SAP and RK/p38 kinases by Pyst1, a novel cytosolic dual-specificity phosphatase. EMBO J. 1996 Jul 15;15(14):3621-32. [PubMed:8670865 ]
  4. Levy-Nissenbaum O, Sagi-Assif O, Witz IP: Characterization of the dual-specificity phosphatase PYST2 and its transcripts. Genes Chromosomes Cancer. 2004 Jan;39(1):37-47. [PubMed:14603440 ]
  5. Levy-Nissenbaum O, Sagi-Assif O, Kapon D, Hantisteanu S, Burg T, Raanani P, Avigdor A, Ben-Bassat I, Witz IP: Dual-specificity phosphatase Pyst2-L is constitutively highly expressed in myeloid leukemia and other malignant cells. Oncogene. 2003 Oct 23;22(48):7649-60. [PubMed:14576828 ]