You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08927
Secondary Accession Numbers
  • 14656
Name Tyrosine-protein phosphatase non-receptor type 12
Synonyms
  1. PTP-PEST
  2. PTPG1
  3. Protein-tyrosine phosphatase G1
Gene Name PTPN12
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Dephosphorylates cellular tyrosine kinases, including PTK2B/PYK2, and thereby regulates signaling via PTK2B/PYK2.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
GO Classification
Cellular Component
cytosol
cell projection
cytoplasm
plasma membrane
cell junction
podosome
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
non-membrane spanning protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 7
Locus 7q11.23
SNPs PTPN12
Gene Sequence
>2343 bp
ATGGAGCAAGTGGAGATCCTGAGGAAATTCATCCAGAGGGTCCAGGCCATGAAGAGTCCT
GACCACAATGGGGAGGACAACTTCGCCCGGGACTTCATGCGGTTAAGAAGATTGTCTACC
AAATATAGAACAGAAAAGATATATCCCACAGCCACTGGAGAAAAAGAAGAAAATGTTAAA
AAGAACAGATACAAGGACATACTGCCATTTGATCACAGCCGAGTTAAATTGACATTAAAG
ACTCCTTCACAAGATTCAGACTATATCAATGCAAATTTTATAAAGGGCGTCTATGGGCCA
AAAGCATATGTAGCAACTCAAGGACCTTTAGCAAATACAGTAATAGATTTTTGGAGGATG
ATATGGGAGTATAATGTTGTGATCATTGTAATGGCCTGCCGAGAATTTGAGATGGGAAGG
AAAAAATGTGAGCGCTATTGGCCTTTGTATGGAGAAGACCCCATAACGTTTGCACCATTT
AAAATTTCTTGTGAGGATGAACAAGCAAGAACAGACTACTTCATCAGGACACTCTTACTT
GAATTTCAAAATGAATCTCGTAGGCTGTATCAGTTTCATTATGTGAACTGGCCAGACCAT
GATGTTCCTTCATCATTTGATTCTATTCTGGACATGATAAGCTTAATGAGGAAATATCAA
GAACATGAAGATGTTCCTATTTGTATTCATTGCAGTGCAGGCTGTGGAAGAACAGGTGCC
ATTTGTGCCATAGATTATACGTGGAATTTACTAAAAGCTGGGAAAATACCAGAGGAATTT
AATGTATTTAATTTAATACAAGAAATGAGAACACAAAGGCATTCTGCAGTACAAACAAAG
GAGCAATATGAACTTGTTCATAGAGCTATTGCCCAACTGTTTGAAAAACAGCTACAACTA
TATGAAATTCATGGAGCTCAGAAAATTGCTGATGGAGTGAATGAAATTAACACTGAAAAC
ATGGTCAGCTCCATAGAGCCTGAAAAACAAGATTCTCCTCCTCCAAAACCACCAAGGACC
CGCAGTTGCCTTGTTGAAGGGGATGCTAAAGAAGAAATACTGCAGCCACCGGAACCTCAT
CCAGTGCCACCCATCTTGACACCTTCTCCCCCTTCAGCTTTTCCAACAGTCACTACTGTG
TGGCAGGACAATGATAGATACCATCCAAAGCCAGTGTTGCATATGGTTTCATCAGAACAA
CATTCAGCAGACCTCAACAGAAACTATAGTAAATCAACAGAACTTCCAGGGAAAAATGAA
TCAACAATTGAACAGATAGATAAAAAATTGGAACGAAATTTAAGTTTTGAGATTAAGAAG
GTCCCTCTCCAAGAGGGACCAAAAAGTTTTGATGGGAACACACTTTTGAATAGGGGACAT
GCAATTAAAATTAAATCTGCTTCACCTTGTATAGCTGATAAAATCTCTAAGCCACAGGAA
TTAAGTTCAGATCTAAATGTCGGTGATACTTCCCAGAATTCTTGTGTGGACTGCAGTGTA
ACACAATCAAACAAAGTTTCAGTTACTCCACCAGAAGAATCCCAGAATTCAGACACACCT
CCAAGGCCAGACCGCTTGCCTCTTGATGAGAAAGGACATGTAACGTGGTCATTTCATGGA
CCTGAAAATGCCATACCCATACCTGATTTATCTGAAGGCAATTCCTCAGATATCAACTAT
CAAACTAGGAAAACTGTGAGTTTAACACCAAGTCCTACAACACAAGTTGAAACACCTGAT
CTTGTGGATCATGATAACACTTCACCACTCTTCAGAACACCCCTCAGTTTTACTAATCCA
CTTCACTCTGATGACTCAGACTCAGATGAAAGAAACTCTGATGGTGCTGTGACCCAGAAT
AAAACTAATATTTCAACAGCAAGTGCCACAGTTTCTGCTGCCACTAGTACTGAAAGCATT
TCTACTAGGAAAGTATTGCCAATGTCCATTGCTAGACATAATATAGCAGGAACAACACAT
TCAGGTGCTGAAAAAGATGTTGATGTTAGTGAAGATTCACCTCCTCCCCTACCTGAAAGA
ACTCCTGAATCGTTTGTGTTAGCAAGTGAACATAATACACCTGTAAGATCGGAATGGAGT
GAACTTCAAAGTCAGGAACGATCTGAACAAAAAAAGTCTGAAGGCTTGATAACCTCTGAA
AATGAGAAATGTGATCATCCAGCGGGAGGTATTCACTATGAAATGTGCATAGAATGTCCA
CCTACTTTCAGTGACAAGAGAGAACAAATATCAGAAAATCCAACAGAAGCCACAGATATT
GGTTTTGGTAATCGATGTGGAAAACCCAAAGGACCAAGAGATCCACCTTCAGAATGGACA
TGA
Protein Properties
Number of Residues 780
Molecular Weight 74137.81
Theoretical pI 5.194
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 12
MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVK
KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRM
IWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLL
EFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA
ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
YEIHGAQKIADGVNEINTENMISSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPH
PVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNE
STIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQE
LSSDLNVGDTSQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHG
PENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNP
LHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESISTRKVLPMSIARHNIAGTTH
SGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSE
NEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEWT
GenBank ID Protein 196114951
UniProtKB/Swiss-Prot ID Q05209
UniProtKB/Swiss-Prot Entry Name PTN12_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002835.3
GeneCard ID PTPN12
GenAtlas ID PTPN12
HGNC ID HGNC:9645
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  5. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  8. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  9. Takekawa M, Itoh F, Hinoda Y, Arimura Y, Toyota M, Sekiya M, Adachi M, Imai K, Yachi A: Cloning and characterization of a human cDNA encoding a novel putative cytoplasmic protein-tyrosine-phosphatase. Biochem Biophys Res Commun. 1992 Dec 15;189(2):1223-30. [PubMed:1472029 ]
  10. Yang Q, Co D, Sommercorn J, Tonks NK: Cloning and expression of PTP-PEST. A novel, human, nontransmembrane protein tyrosine phosphatase. J Biol Chem. 1993 Mar 25;268(9):6622-8. [PubMed:8454633 ]
  11. Yang Q, Co D, Sommercorn J, Tonks NK: Cloning and expression of PTP-PEST. A novel, human, nontransmembrane protein tyrosine phosphatase. J Biol Chem. 1993 Aug 15;268(23):17650. [PubMed:8349645 ]
  12. Takekawa M, Itoh F, Hinoda Y, Adachi M, Ariyama T, Inazawa J, Imai K, Yachi A: Chromosomal localization of the protein tyrosine phosphatase G1 gene and characterization of the aberrant transcripts in human colon cancer cells. FEBS Lett. 1994 Feb 21;339(3):222-8. [PubMed:7509295 ]
  13. Li J, Nishizawa K, An W, Hussey RE, Lialios FE, Salgia R, Sunder-Plassmann R, Reinherz EL: A cdc15-like adaptor protein (CD2BP1) interacts with the CD2 cytoplasmic domain and regulates CD2-triggered adhesion. EMBO J. 1998 Dec 15;17(24):7320-36. [PubMed:9857189 ]