You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08934
Secondary Accession Numbers
  • 14663
Name Tyrosine-protein phosphatase non-receptor type 2
Synonyms
  1. T-cell protein-tyrosine phosphatase
  2. TCPTP
Gene Name PTPN2
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Not Available
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
GO Classification
Biological Process
interferon-gamma-mediated signaling pathway
insulin receptor signaling pathway
regulation of interferon-gamma-mediated signaling pathway
Cellular Component
endoplasmic reticulum
nucleoplasm
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
non-membrane spanning protein tyrosine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 18
Locus 18p11.3-p11.2
SNPs PTPN2
Gene Sequence
>1248 bp
ATGCCCACCACCATCGAGCGGGAGTTCGAAGAGTTGGATACTCAGCGTCGCTGGCAGCCG
CTGTACTTGGAAATTCGAAATGAGTCCCATGACTATCCTCATAGAGTGGCCAAGTTTCCA
GAAAACAGAAATCGAAACAGATACAGAGATGTAAGCCCATATGATCACAGTCGTGTTAAA
CTGCAAAATGCTGAGAATGATTATATTAATGCCAGTTTAGTTGACATAGAAGAGGCACAA
AGGAGTTACATCTTAACACAGGGTCCACTTCCTAACACATGCTGCCATTTCTGGCTTATG
GTTTGGCAGCAGAAGACCAAAGCAGTTGTCATGCTGAACCGCATTGTGGAGAAAGAATCG
GTTAAATGTGCACAGTACTGGCCAACAGATGACCAAGAGATGCTGTTTAAAGAAACAGGA
TTCAGTGTGAAGCTCTTGTCAGAAGATGTGAAGTCGTATTATACAGTACATCTACTACAA
TTAGAAAATATCAATAGTGGTGAAACCAGAACAATATCTCACTTTCATTATACTACCTGG
CCAGATTTTGGAGTCCCTGAATCACCAGCTTCATTTCTCAATTTCTTGTTTAAAGTGAGA
GAATCTGGCTCCTTGAACCCTGACCATGGGCCTGCGGTGATCCACTGTAGTGCAGGCATT
GGGCGCTCTGGCACCTTCTCTCTGGTAGACACTTGTCTTGTTTTGATGGAAAAAGGAGAT
GATATTAACATAAAACAAGTGTTACTGAACATGAGAAAATACCGAATGGGTCTTATTCAG
ACCCCAGATCAACTGAGATTCTCATACATGGCTATAATAGAAGGAGCAAAATGTATAAAG
GGAGATTCTAGTATACAGAAACGATGGAAAGAACTTTCTAAGGAAGACTTATCTCCTGCC
TTTGATCATTCACCAAACAAAATAATGACTGAAAAATACAATGGGAACAGAATAGGTCTA
GAAGAAGAAAAACTGACAGGTGACCGATGTACAGGACTTTCCTCTAAAATGCAAGATACA
ATGGAGGAGAACAGTGAGAGTGCTCTACGGAAACGTATTCGAGAGGACAGAAAGGCCACC
ACAGCTCAGAAGGTGCAGCAGATGAAACAGAGGCTAAATGAGAATGAACGAAAAAGAAAA
AGGTGGTTATATTGGCAACCTATTCTCACTAAGATGGGGTTTATGTCAGTCATTTTGGTT
GGCGCTTTTGTTGGCTGGACACTGTTTTTTCAGCAAAATGCCCTATAA
Protein Properties
Number of Residues 415
Molecular Weight 48472.94
Theoretical pI 8.291
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 2
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
GenBank ID Protein 158258577
UniProtKB/Swiss-Prot ID P17706
UniProtKB/Swiss-Prot Entry Name PTN2_HUMAN
PDB IDs
GenBank Gene ID AK292570
GeneCard ID PTPN2
GenAtlas ID PTPN2
HGNC ID HGNC:9650
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Cool DE, Tonks NK, Charbonneau H, Walsh KA, Fischer EH, Krebs EG: cDNA isolated from a human T-cell library encodes a member of the protein-tyrosine-phosphatase family. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5257-61. [PubMed:2546150 ]
  7. Mosinger B Jr, Tillmann U, Westphal H, Tremblay ML: Cloning and characterization of a mouse cDNA encoding a cytoplasmic protein-tyrosine-phosphatase. Proc Natl Acad Sci U S A. 1992 Jan 15;89(2):499-503. [PubMed:1731319 ]
  8. Stenzinger A, Kajosch T, Tag C, Porsche A, Welte I, Hofer HW, Steger K, Wimmer M: The novel protein PTPIP51 exhibits tissue- and cell-specific expression. Histochem Cell Biol. 2005 Jan;123(1):19-28. Epub 2004 Dec 18. [PubMed:15609043 ]
  9. Iversen LF, Moller KB, Pedersen AK, Peters GH, Petersen AS, Andersen HS, Branner S, Mortensen SB, Moller NP: Structure determination of T cell protein-tyrosine phosphatase. J Biol Chem. 2002 May 31;277(22):19982-90. Epub 2002 Mar 20. [PubMed:11907034 ]