Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08940
Secondary Accession Numbers
  • 14669
Name Receptor-type tyrosine-protein phosphatase beta
Synonyms
  1. Protein-tyrosine phosphatase beta
  2. R-PTP-beta
  3. VE-PTP
  4. Vascular endothelial protein tyrosine phosphatase
Gene Name PTPRB
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Plays an important role in blood vessel remodeling and angiogenesis. Not necessary for the initial formation of blood vessels, but is essential for their maintenance and remodeling. Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin and KDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelial cells. Acts as a negative regulator of TIE2, and controls TIE2 driven endothelial cell proliferation, which in turn affects blood vessel remodeling during embryonic development and determines blood vessel size during perinatal growth. Essential for the maintenance of endothelial cell contact integrity and for the adhesive function of VE-cadherin in endothelial cells and this requires the presence of plakoglobin (By similarity).
Pathways
  • Adherens junction
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
GO Classification
Biological Process
angiogenesis
Cellular Component
integral to plasma membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
transmembrane receptor protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location 12
Locus 12q15-q21
SNPs PTPRB
Gene Sequence
>5994 bp
ATGCTGAGCCATGGAGCCGGGTTGGCCTTGTGGATCACACTGAGCCTGCTGCAGACTGGA
CTGGCGGAGCCAGAGAGATGTAACTTCACCCTGGCGGAGTCCAAGGCCTCCAGCCATTCT
GTGTCTATCCAGTGGAGAATTTTGGGCTCACCCTGTAACTTTAGCCTCATCTATAGCAGT
GACACCCTGGGGGCCGCGTTGTGCCCTACCTTTCGGATAGACAACACCACATACGGATGT
AACCTTCAAGATTTACAAGCAGGAACCATCTATAACTTCAAGATTATTTCTCTGGATGAA
GAGAGAACTGTGGTCTTGCAAACAGATCCTTTACCTCCTGCTAGGTTTGGAGTCAGTAAA
GAGAAGACGACTTCAACCGGCTTGCATGTTTGGTGGACTCCTTCTTCCGGAAAAGTCACC
TCATATGAGGTGCAATTATTTGATGAAAATAACCAAAAGATACAGGGGGTTCAAATTCAA
GAAAGTACTTCATGGAATGAATACACTTTTTTCAATCTCACTGCTGGTAGTAAATACAAT
ATTGCCATCACAGCTGTTTCTGGAGGAAAACGTTCTTTTTCAGTTTATACCAATGGATCA
ACAGTGCCATCTCCAGTGAAAGATATTGGTATTTCCACAAAAGCCAATTCTCTCCTGATT
TCCTGGTCCCATGGTTCTGGGAATGTGGAACGATACCGGCTGATGCTAATGGATAAAGGG
ATCCTAGTTCATGGCGGTGTTGTGGACAAACATGCTACTTCCTATGCTTTTCACGGGCTG
TCCCCTGGCTACCTCTACAACCTCACTGTTATGACTGAGGCTGCAGGGCTGCAAAACTAC
AGGTGGAAACTAGTCAGGACAGCCCCCATGGAAGTCTCAAATCTGAAGGTGACAAATGAT
GGCAGTTTGACCTCTCTAAAAGTCAAATGGCAAAGACCTCCTGGAAATGTGGATTCTTAC
AATATCACCCTGTCTCACAAAGGGACCATCAAGGAATCCAGAGTATTAGCACCTTGGATT
ACTGAAACTCACTTTAAAGAGTTAGTCCCCGGTCGACTTTATCAAGTTACTGTCAGCTGT
GTCTCTGGTGAACTGTCTGCTCAGAAGATGGCAGTGGGCAGAACATTTCCAGACAAAGTT
GCAAACCTGGAGGCAAACAATAATGGCAGGATGAGGTCTCTTGTAGTGAGCTGGTCGCCC
CCTGCTGGAGACTGGGAGCAGTATCGGATCCTACTCTTCAATGATTCTGTGGTGCTGCTC
AACATCACTGTGGGAAAGGAAGAAACACAGTATGTCATGGATGACACGGGGCTCGTACCG
GGAAGACAGTATGAGGTGGAAGTCATTGTTGAGAGTGGAAATTTGAAGAATTCTGAGCGT
TGCCAAGGCAGGACAGTCCCCCTGGCTGTCCTCCAGCTTCGTGTCAAACATGCCAATGAA
ACCTCACTGAGTATCATGTGGCAGACCCCTGTAGCAGAATGGGAGAAATACATCATTTCC
CTAGCTGACAGAGACCTCTTACTGATCCACAAGTCACTCTCCAAAGATGCCAAAGAATTC
ACTTTTACTGACCTGGTGCCTGGACGAAAATACATGGCTACAGTCACCAGTATTAGTGGA
GACTTAAAAAATTCCTCTTCAGTAAAAGGAAGAACAGTGCCTGCCCAAGTGACTGACTTG
CATGTGGCCAACCAAGGAATGACCAGTAGTCTGTTTACTAACTGGACCCAGGCACAAGGA
GACGTAGAATTTTACCAAGTCTTACTGATCCATGAAAATGTGGTCATTAAAAATGAAAGC
ATCTCCAGTGAGACCAGCAGATACAGCTTCCACTCTCTCAAGTCCGGCAGCCTGTACTCC
GTGGTGGTAACAACAGTGAGTGGAGGGATCTCTTCCCGACAAGTGGTTGTGGAGGGAAGA
ACAGTCCCTTCCAGTGTGAGTGGAGTAACGGTGAACAATTCCGGTCGTAATGACTACCTC
AGCGTTTCCTGGCTCGTGGCGCCCGGAGATGTGGATAACTATGAGGTAACATTGTCTCAT
GACGGCAAGGTGGTTCAGTCCCTTGTCATTGCCAAGTCTGTCAGAGAATGTTCCTTCAGC
TCCCTCACCCCAGGCCGCCTCTACACCGTGACCATAACTACAAGGAGTGGCAAGTATGAA
AATCACTCCTTCAGCCAAGAGCGGACAGTGCCTGACAAAGTCCAGGGAGTCAGTGTTAGC
AACTCAGCCAGGAGTGACTATTTAAGGGTATCCTGGGTGCATGCCACTGGAGACTTTGAT
CACTATGAAGTCACCATTAAAAACAAAAACAACTTCATTCAAACTAAAAGCATTCCCAAG
TCAGAAAACGAATGTGTATTTGTTCAGCTAGTCCCTGGACGGTTGTACAGTGTCACTGTT
ACTACAAAAAGTGGACAATATGAAGCCAATGAACAAGGGAATGGGAGAACAATTCCAGAG
CCTGTTAAGGATCTAACATTGCGCAACAGGAGCACTGAGGACTTGCATGTGACTTGGTCA
GGAGCTAATGGGGATGTCGACCAATATGAGATCCAGCTGCTCTTCAATGACATGAAAGTA
TTTCCTCCTTTTCACCTTGTAAATACCGCAACCGAGTATCGATTTACTTCCCTAACACCA
GGCCGCCAATACAAAATTCTTGTCTTGACGATTAGCGGGGATGTACAGCAGTCAGCCTTC
ATTGAGGGCTTCACAGTTCCTAGTGCTGTCAAAAATATTCACATTTCTCCCAATGGAGCA
ACAGATAGCCTGACGGTGAACTGGACTCCTGGTGGGGGAGACGTTGATTCCTACACGGTG
TCGGCATTCAGGCACAGTCAAAAGGTTGACTCTCAGACTATTCCCAAGCACGTCTTTGAG
CACACGTTCCACAGACTGGAGGCCGGGGAGCAGTACCAGATCATGATTGCCTCAGTCAGC
GGGTCCCTGAAGAATCAGATAAATGTGGTTGGGCGGACAGTTCCAGCATCTGTCCAAGGA
GTAATTGCAGACAATGCATACAGCAGTTATTCCTTAATAGTAAGTTGGCAAAAAGCTGCT
GGTGTGGCAGAAAGATATGATATCCTGCTTCTAACTGAAAATGGAATCCTTCTGCGCAAC
ACATCAGAGCCAGCCACCACTAAGCAACACAAATTTGAAGATCTAACACCAGGCAAGAAA
TACAAGATACAGATCCTAACTGTCAGTGGAGGCCTCTTTAGCAAGGAAGCCCAGACTGAA
GGCCGAACAGTCCCAGCAGCTGTCACCGACCTGAGGATCACAGAGAACTCCACCAGGCAC
CTGTCCTTCCGCTGGACCGCCTCAGAGGGGGAGCTCAGCTGGTACAACATCTTTTTGTAC
AACCCAGATGGGAATCTCCAGGAGAGAGCTCAAGTTGACCCACTAGTCCAGAGCTTCTCT
TTCCAGAACTTGCTACAAGGCAGAATGTACAAGATGGTGATTGTAACTCACAGTGGGGAG
CTGTCTAATGAGTCTTTCATATTTGGTAGAACAGTCCCAGCCTCTGTGAGTCATCTCAGG
GGGTCCAATCGGAACACGACAGACAGCCTTTGGTTCAACTGGAGTCCAGCCTCTGGGGAC
TTTGACTTTTATGAGCTGATTCTCTATAATCCCAATGGCACAAAGAAGGAAAACTGGAAA
GACAAGGACCTGACGGAGTGGCGGTTTCAAGGCCTTGTTCCTGGAAGGAAGTACGTGCTG
TGGGTGGTAACTCACAGTGGAGATCTCAGCAATAAAGTCACAGCGGAGAGCAGAACAGCT
CCAAGTCCTCCCAGTCTTATGTCATTTGCTGACATTGCAAACACATCCTTGGCCATCACG
TGGAAAGGGCCCCCAGACTGGACAGACTACAACGACTTTGAGCTGCAGTGGTTGCCCAGA
GATGCACTTACTGTCTTCAACCCCTACAACAACAGAAAATCAGAAGGACGCATTGTGTAT
GGTCTTCGTCCAGGGAGATCCTATCAATTCAACGTCAAGACTGTCAGTGGTGATTCCTGG
AAAACTTACAGCAAACCAATTTTTGGATCTGTGAGGACAAAGCCTGACAAGATACAAAAC
CTGCATTGCCGGCCTCAGAACTCCACGGCCATTGCCTGTTCTTGGATCCCTCCTGATTCT
GACTTTGATGGTTATAGTATTGAATGCCGGAAAATGGACACCCAAGAAGTTGAGTTTTCC
AGAAAGCTGGAGAAAGAAAAATCTCTGCTCAACATCATGATGCTAGTGCCCCATAAGAGG
TACCTGGTGTCCATCAAAGTGCAGTCGGCCGGCATGACCAGCGAGGTGGTTGAAGACAGC
ACTATCACAATGATAGACCGCCCCCCTCCTCCACCCCCACACATTCGTGTGAATGAAAAG
GATGTGCTAATTAGCAAGTCTTCCATCAACTTTACTGTCAACTGCAGCTGGTTCAGCGAC
ACCAATGGAGCTGTGAAATACTTCACAGTGGTGGTGAGAGAGGCTGATGGCAGTGATGAG
CTGAAGCCAGAACAGCAGCACCCTCTCCCTTCCTACCTGGAGTACAGGCACAATGCCTCC
ATTCGGGTGTATCAGACTAATTATTTTGCCAGCAAATGTGCCGAAAATCCTAACAGCAAC
TCCAAGAGTTTTAACATTAAGCTTGGAGCAGAGATGGAGAGCTTAGGTGGAAAACGCGAT
CCCACTCAGCAAAAATTCTGTGATGGACCACTGAAGCCACACACTGCCTACAGAATCAGC
ATTCGAGCTTTTACACAGCTCTTTGATGAGGACCTGAAGGAATTCACAAAGCCACTCTAT
TCAGACACATTTTTTTCTTTACCCATCACTACTGAATCAGAGCCCTTGTTTGGAGCTATT
GAAGGTGTGAGTGCTGGTCTGTTTTTAATTGGCATGCTAGTGGCTGTTGTTGCCTTATTG
ATCTGCAGACAGAAAGTGAGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGT
AGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGGTAACCGGAAAACTTCT
TGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAAC
TACCTTCTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGAC
ATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAATATATTGCCCTATGAT
GCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCC
AGCTACATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCT
GGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGTTCACAACATCGTCATG
GTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGACCATTACTGGCCAGCGGACCAG
GATTCCCTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAG
TGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGATGCACACAGACTCATC
CGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTG
ATCCAGTTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACT
GTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTATTGCATTGGACCGAATC
CTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGA
CTTCACAGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTA
AGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAACCCCTTGTTTCCAATC
TATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGA
Protein Properties
Number of Residues 1997
Molecular Weight 249141.73
Theoretical pI 7.739
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase beta
MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSS
DTLGAALCPTFRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSK
EKTTSTSLHVWWTPSSGKVTSYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYN
IAITAVSGGKRSFSVYTNGSTVPSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDKG
ILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNYRWKLVRTAPMEVSNLKVTND
GSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVPGRLYQVTVSC
VSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANE
TSLSIMWQTPVAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISG
DLKNSSSVKGRTVPAQVTDLHVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNES
ISSETSRYSFHSLKSGSLYSVVVTTVSGGISSRQVVVEGRTVPSSVSGVTVNNSGRNDYL
SVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFSSLTPGRLYTVTITTRSGKYE
NHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKNNFIQTKSIPK
SENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAF
IEGFTVPSAVKNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFE
HTFHRLEAGEQYQIMIASVSGSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAA
GVAERYDILLLTENGILLRNTSEPATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAQTE
GRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLYNPDGNLQERAQVDPLVQSFS
FQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSLWFNWSPASGD
FDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVY
GLRPGRSYQFNVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDS
DFDGYSIECRKMDTQEVEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDS
TITMIDRPPPPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFTVVVREADGNDE
LKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCD
PTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAI
EGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYD
ATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVM
VTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLI
RHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRI
LQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPI
YENVNPEYHRDPVYSRH
GenBank ID Protein 35788
UniProtKB/Swiss-Prot ID P23467
UniProtKB/Swiss-Prot Entry Name PTPRB_HUMAN
PDB IDs
GenBank Gene ID X54131
GeneCard ID PTPRB
GenAtlas ID PTPRB
HGNC ID HGNC:9665
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  4. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  5. Mellberg S, Dimberg A, Bahram F, Hayashi M, Rennel E, Ameur A, Westholm JO, Larsson E, Lindahl P, Cross MJ, Claesson-Welsh L: Transcriptional profiling reveals a critical role for tyrosine phosphatase VE-PTP in regulation of VEGFR2 activity and endothelial cell morphogenesis. FASEB J. 2009 May;23(5):1490-502. doi: 10.1096/fj.08-123810. Epub 2009 Jan 9. [PubMed:19136612 ]
  6. Yacyshyn OK, Lai PF, Forse K, Teichert-Kuliszewska K, Jurasz P, Stewart DJ: Tyrosine phosphatase beta regulates angiopoietin-Tie2 signaling in human endothelial cells. Angiogenesis. 2009;12(1):25-33. doi: 10.1007/s10456-008-9126-0. Epub 2009 Jan 1. [PubMed:19116766 ]
  7. Winderlich M, Keller L, Cagna G, Broermann A, Kamenyeva O, Kiefer F, Deutsch U, Nottebaum AF, Vestweber D: VE-PTP controls blood vessel development by balancing Tie-2 activity. J Cell Biol. 2009 May 18;185(4):657-71. doi: 10.1083/jcb.200811159. [PubMed:19451274 ]
  8. Krueger NX, Streuli M, Saito H: Structural diversity and evolution of human receptor-like protein tyrosine phosphatases. EMBO J. 1990 Oct;9(10):3241-52. [PubMed:2170109 ]
  9. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. [PubMed:19167335 ]
  10. Evdokimov AG, Pokross M, Walter R, Mekel M, Cox B, Li C, Bechard R, Genbauffe F, Andrews R, Diven C, Howard B, Rastogi V, Gray J, Maier M, Peters KG: Engineering the catalytic domain of human protein tyrosine phosphatase beta for structure-based drug discovery. Acta Crystallogr D Biol Crystallogr. 2006 Dec;62(Pt 12):1435-45. Epub 2006 Nov 23. [PubMed:17139078 ]
  11. Amarasinghe KK, Evdokimov AG, Xu K, Clark CM, Maier MB, Srivastava A, Colson AO, Gerwe GS, Stake GE, Howard BW, Pokross ME, Gray JL, Peters KG: Design and synthesis of potent, non-peptidic inhibitors of HPTPbeta. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4252-6. Epub 2006 Jun 12. [PubMed:16759857 ]