You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08967
Secondary Accession Numbers
  • 14701
Name Glutamate decarboxylase-like protein 1
Synonyms Not Available
Gene Name GADL1
Protein Type Enzyme
Biological Properties
General Function Involved in carboxy-lyase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3p24.1-p23
SNPs GADL1
Gene Sequence
>1566 bp
ATGAGCAGCGACTCGGACCGCCAGTGTCCTGTGGACGGAGATATTGATCAACAAGAGATG
ATTCCAAGTAAGAAGAATGCTGTTCTTGTGGATGGGGTTGTGCTGAATGGTCCTACAACA
GATGCAAAAGCTGGAGAAAAATTTGTTGAAGAGGCCTGTAGGCTAATAATGGAAGAGGTG
GTTTTGAAAGCTACAGATGTCAATGAGAAGGTGTGTGAATGGAGGCCTCCTGAACAACTG
AAACAGCTTCTTGATTTGGAGATGAGAGACTCAGGCGAGCCACCCCATAAACTATTGGAA
CTCTGTCGGGATGTCATACACTACAGTGTCAAAACTAACCACCCAAGATTTTTCAACCAA
TTGTATGCTGGACTTGATTATTACTCCTTGGTGGCCCGATTTATGACCGAAGCATTGAAT
CCAAGTGTTTATACGTATGAGGTGTCCCCAGTGTTTCTGTTAGTGGAAGAAGCGGTTCTG
AAGAAAATGATTGAATTTATTGGCTGGAAAGAAGGGGATGGAATATTTAACCCAGGTGGC
TCAGTGTCCAATATGTATGCAATGAATTTAGCTAGATACAAATATTGTCCTGATATTAAG
GAAAAGGGGCTGTCTGGTTCGCCAAGATTAATCCTTTTCACATCTGCAGAGTGTCATTAC
TCTATGAAGAAGGCAGCCTCTTTTCTTGGGATTGGCACTGAGAATGTTTGCTTTGTGGAA
ACAGATGGAAGAGGTAAAATGATACCTGAGGAACTGGAGAAGCAAGTCTGGCAAGCCAGA
AAAGAGGGGGCAGCACCGTTTCTTGTCTGTGCCACTTCTGGTACAACTGTGTTGGGAGCT
TTTGACCCTCTGGATGAAATAGCAGACATCTGCGAGAGGCACAGCCTCTGGCTTCATGTA
GATGCTTCTTGGGGTGGCTCAGCTTTGATGTCGAGGAAGCACCGCAAGCTTCTGCATGGC
ATCCACAGGGCTGACTCTGTGGCCTGGAACCCACACAAGATGCTGATGGCTGGGATCCAG
TGCTGTGCTCTCCTTGTGAAAGACAAATCTGATCTTCTTAAAAAATGCTACTCTGCCAAG
GCATCTTACCTCTTCCAGCAGGATAAATTCTATGATGTGAGCTATGACACAGGAGACAAG
TCTATCCAGTGTAGCAGAAGACCAGATGCATTCAAGTTCTGGATGACCTGGAAGGCCCTG
GGTACATTAGGCCTTGAAGAAAGAGTTAATCGTGCTCTTGCTTTATCTAGGTACCTAGTA
GATGAAATCAAGAAAAGAGAAGGATTCAAGTTACTGATGGAACCTGAATATGCCAATATT
TGCTTTTGGTACATTCCACCGAGCCTCAGAGAGATGGAAGAAGGACCCGAGTTCTGGGCA
AAACTTAATTTGGTGGCCCCAGCCATTAAGGAGAGGATGATGAAGAAGGGAAGCTTGATG
CTGGGCTACCAGCCGCACCGGGGAAAGGTCAACTTCTTCCGCCAGGTGGTGATCAGCCCT
CAAGTGAGCCGGGAGGACATGGACTTCCTCCTGGATGAGATAGACTTACTGGGTAAAGAC
ATGTAG
Protein Properties
Number of Residues 521
Molecular Weight 59245.9
Theoretical pI 6.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Glutamate decarboxylase-like protein 1
MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLM
LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM
GenBank ID Protein 197383062
UniProtKB/Swiss-Prot ID Q6ZQY3
UniProtKB/Swiss-Prot Entry Name GADL1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_207359.2
GeneCard ID GADL1
GenAtlas ID GADL1
HGNC ID HGNC:27949
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]