You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08972
Secondary Accession Numbers
  • 14706
Name Serine dehydratase-like
Synonyms
  1. L-serine deaminase
  2. L-serine dehydratase/L-threonine deaminase
  3. L-threonine dehydratase
  4. SDH 2
  5. Serine dehydratase 2
  6. TDH
Gene Name SDSL
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Has low serine dehydratase and threonine dehydratase activity.
Pathways Not Available
Reactions
L-Serine → Pyruvic acid + Ammonia details
L-Threonine → 2-Ketobutyric acid + Ammonia details
GO Classification
Biological Process
cellular amino acid metabolic process
Cellular Component
mitochondrion
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
Molecular Function
pyridoxal phosphate binding
L-serine ammonia-lyase activity
L-threonine ammonia-lyase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q24.13
SNPs SDSL
Gene Sequence
>990 bp
ATGGACGGCCCTGTGGCAGAGCATGCCAAGCAGGAGCCCTTTCACGTGGTCACACCTCTG
TTGGAGAGCTGGGCGCTGTCCCAGGTGGCGGGCATGCCTGTCTTCCTCAAGTGTGAGAAT
GTGCAGCCCAGCGGCTCCTTCAAGATTCGGGGCATTGGGCATTTCTGCCAGGAGATGGCC
AAGAAGGGATGCAGACACCTGGTGTGCTCCTCAGGGGGTAATGCGGGCATCGCTGCTGCC
TATGCTGCTAGGAAGCTGGGCATTCCTGCCACCATCGTGCTCCCCGAGAGCACCTCCCTG
CAGGTGGTGCAGAGGCTGCAGGGGGAGGGGGCCGAGGTTCAGCTGACTGGAAAGGTCTGG
GACGAGGCCAATCTGAGGGCGCAAGAGTTGGCCAAGAGGGACGGCTGGGAGAATGTCCCC
CCGTTTGACCACCCCCTAATATGGAAAGGCCACGCCAGCCTGGTGCAGGAGCTGAAAGCA
GTGCTGAGGACCCCACCAGGTGCCCTGGTGCTGGCAGTTGGGGGTGGGGGTCTCCTGGCC
GGGGTGGTGGCTGGCCTGCTGGAGGTGGGCTGGCAGCATGTACCCATCATTGCCATGGAG
ACCCATGGGGCACACTGCTTCAATGCGGCCATCACAGCCGGCAAGCTGGTCACACTTCCA
GACATCACCAGTGTGGCCAAGAGCCTGGGTGCCAAGACGGTGGCCGCTCGGGCCCTGGAG
TGCATGCAGGTGTGCAAGATTCACTCTGAAGTGGTGGAGGACACCGAGGCTGTGAGCGCT
GTGCAGCAGCTCCTGGATGATGAGCGTATGCTGGTGGAGCCTGCCTGTGGGGCAGCCTTA
GCAGCCATCTACTCAGGCCTCCTGCGGAGGCTCCAGGCCGAGGGCTGCCTGCCCCCTTCC
CTGACTTCAGTTGTGGTAATCGTGTGTGGAGGCAACAACATCAACAGCCGAGAGCTGCAG
GCTTTGAAAACCCACCTGGGCCAGGTCTGA
Protein Properties
Number of Residues 329
Molecular Weight 34674.01
Theoretical pI 6.883
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine dehydratase-like
MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMA
KKGCRHLVCSSGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVW
DEANLRAQELAKRDGWENVPPFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLA
GVVAGLLEVGWQHVPIIAMETHGAHCFNAAITAGKLVTLPDITSVAKSLGAKTVAARALE
CMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAALAAIYSGLLRRLQAEGCLPPS
LTSVVVIVCGGNNINSRELQALKTHLGQV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96GA7
UniProtKB/Swiss-Prot Entry Name SDSL_HUMAN
PDB IDs
GenBank Gene ID AF134473
GeneCard ID SDSL
GenAtlas ID SDSL
HGNC ID HGNC:30404
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yamada T, Komoto J, Kasuya T, Takata Y, Ogawa H, Mori H, Takusagawa F: A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: crystal structure and site-directed mutagenesis studies. Biochim Biophys Acta. 2008 May;1780(5):809-18. doi: 10.1016/j.bbagen.2008.01.020. Epub 2008 Feb 19. [PubMed:18342636 ]