You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09021
Secondary Accession Numbers
  • 14763
Name Histone-lysine N-methyltransferase MLL5
Synonyms
  1. KMT2E
  2. Lysine N-methyltransferase 2E
  3. Myeloid/lymphoid or mixed-lineage leukemia protein 5
Gene Name MLL5
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Histone methyltransferase that specifically mono- and dimethylates 'Lys-4' of histone H3 (H3K4me1 and H3K4me2). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Key regulator of hematopoiesis involved in terminal myeloid differentiation and in the regulation of hematopoietic stem cell (HSCs) self-renewal by a mechanism that involves DNA methylation. Plays an essential role in retinoic-acid-induced granulopoiesis by acting as a coactivator of RAR-alpha (RARA) in target gene promoters. Also acts as an important cell cycle regulator, participating in cell cycle regulatory network machinery at multiple cell cycle stages. Required to suppress inappropriate expression of S-phase-promoting genes and maintain expression of determination genes in quiescent cells. Overexpression inhibits cell cycle progression, while knockdown induces cell cycle arrest at both the G1 and G2/M phases.
Pathways
  • Lysine degradation
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
cell cycle arrest
positive regulation of transcription, DNA-dependent
erythrocyte differentiation
cellular response to retinoic acid
transcription, DNA-dependent
retinoic acid receptor signaling pathway
DNA methylation
neutrophil activation
neutrophil mediated immunity
positive regulation of granulocyte differentiation
Cellular Component
nuclear speck
MLL5-L complex
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Molecular Function
metal ion binding
zinc ion binding
transcription coactivator activity
histone methyltransferase activity (H3-K4 specific)
Cellular Location
  1. Nucleus speckle
Gene Properties
Chromosome Location 7
Locus 7q22.1
SNPs MLL5
Gene Sequence
>5577 bp
ATGAGCATAGTGATCCCATTGGGGGTTGATACAGCAGAGACGTCATACTTGGAAATGGCT
GCAGGTTCAGAACCAGAATCCGTAGAAGCTAGCCCTGTGGTAGTTGAGAAATCCAACAGT
TATCCCCACCAGTTATATACCAGCAGCTCACATCATTCACACAGTTACATTGGTTTGCCC
TATGCGGACCATAATTATGGTGCTCGTCCTCCTCCGACACCTCCGGCTTCCCCTCCTCCA
TCAGTCCTTATTAGCAAAAATGAAGTAGGCATATTTACCACTCCTAATTTTGATGAAACT
TCCAGTGCTACTACAATCAGCACATCTGAGGATGGAAGTTATGGTACTGATGTAACCAGG
TGCATATGTGGTTTTACACATGATGATGGATACATGATCTGTTGTGACAAATGCAGCGTT
TGGCAACATATTGACTGCATGGGGATTGATAGGCAGCATATTCCTGATACATATCTATGT
GAACGTTGTCAGCCTAGGAATTTGGATAAAGAGAGGGCAGTGCTACTACAACGCCGGAAA
AGGGAAAATATGTCAGATGGTGATACCAGTGCAACTGAGAGTGGTGATGAGGTTCCTGTG
GAATTATATACTGCATTTCAGCATACTCCAACATCAATTACTTTAACTGCTTCAAGAGTT
TCCAAAGTTAATGATAAAAGAAGGAAAAAAAGCGGGGAGAAAGAACAACACATTTCAAAA
TGTAAAAAGGCATTTCGTGAAGGATCTAGGAAGTCATCAAGAGTTAAGGGTTCAGCTCCA
GAGATTGATCCTTCATCTGATGGTTCAAATTTTGGATGGGAGACAAAGATCAAAGCATGG
ATGGATCGATATGAAGAAGCAAATAACAACCAGTACAGTGAGGGTGTTCAGAGGGAGGCA
CAAAGAATAGCTCTGAGATTAGGCAATGGAAATGACAAAAAAGAGATGAATAAATCCGAT
TTGAATACCAACAATTTGCTCTTCAAACCTCCTGTAGAGAGCCATATACAAAAGAATAAG
AAAATTCTTAAATCTGCAAAAGATTTGCCTCCTGATGCACTTATCATTGAATACAGAGGG
AAGTTTATGCTGAGAGAACAGTTTGAAGCAAATGGGTATTTCTTTAAAAGACCATACCCT
TTTGTGTTATTCTACTCTAAATTTCATGGGCTAGAAATGTGTGTTGATGCAAGGACTTTT
GGGAATGAGGCTCGATTCATCAGGCGGTCTTGTACACCCAATGCAGAGGTGAGGCATGAA
ATTCAAGATGGAACCATACATCTTTATATTTATTCTATACACAGTATTCCAAAGGGAACT
GAAATTACTATTGCCTTTGATTTTGACTATGGAAATTGTAAGTACAAGGTGGACTGTGCA
TGCCTCAAAGAAAACCCAGAGTGCCCTGTTCTAAAACGTAGTTCTGAATCCATGGAAAAT
ATCAATAGTGGTTATGAGACCAGACGGAAAAAAGGAAAAAAAGACAAAGATATTTCAAAA
GAAAAAGATACACAAAATCAGAATATTACTTTGGATTGTGAAGGAACGACCAACAAAATG
AAGAGCCCAGAAACTAAACAAAGAAAGCTTTCTCCACTGAGACTATCAGTATCAAATAAT
CAGGAACCAGATTTTATTGATGATATAGAAGAAAAAACTCCTATTAGTAATGAAGTAGAA
ATGGAATCAGAGGAGCAGATTGCAGAAAGGAAAAGGAAGATGACAAGAGAAGAAAGAAAA
ATGGAAGCAATTTTGCAAGCTTTTGCCAGACTTGAAAAGAGAGAGAAAAGAAGAGAACAA
GCTTTGGAAAGGATCAGCACAGCCAAAACTGAAGTTAAAACTGAATGTAAAGATACACAG
ATTGTCAGTGATGCTGAAGTTATTCAGGAACAAGCAAAAGAAGAAAATGCTAGCAAGCCA
ACCCCTGCCAAAGTAAATAGAACTAAACAGAGAAAAAGTTTTTCTCGGAGTAGGACTCAC
ATTGGACAGCAGCGTCGGAGACACAGAACTGTCAGCATGTGTTCAGATATCCAGCCATCT
TCTCCTGATATAGAAGTTACTTCACAACAAAATGATATTGAAAATACTGTACTTACAATA
GAACCAGAAACTGAAACTGCACTAGCAGAAATAATTACTGAAACTGAAGTTCCAGCACTT
AATAAATGTCCTACCAAGTACCCCAAAACAAAGAAGCACTTGGTTAATGAATGGTTAAGT
GAGAAGAATGAGAAGACAGGAAAACCTTCAGATGGCCTTTCAGAAAGGCCTCTACGCATA
ACTACAGATCCTGAAGTGTTAGCTACACAACTCAATTCTTTACCAGGTCTCACTTACAGC
CCCCATGTATACTCCACTCCTAAGCATTATATTAGATTTACTTCACCATTCCTTTCAGAA
AAAAGGAGAAGAAAAGAACCTACTGAAAACATTTCTGGTTCATGCAAGAAGCGATGGTTG
AAACAAGCTCTGGAAGAAGAAAATTCAGCAATTTTACATAGATTTAATTCACCCTGTCAA
GAAAGATCCAGAAGTCCTGCAGTCAATGGTGAAAATAAAAGTCCACTACTATTAAATGAC
AGCTGTTCCCTTCCAGATTTAACTACACCACTAAAAAAACGAAGATTTTATCAGTTGCTA
GATTCGGTTTACTCAGAAACCTCCACACCTACTCCTTCCCCGTATGCTACACCAACTCAC
ACCGATATTACTCCTATGGACCCATCTTTTGCCACGCCTCCACGGATAAAATCAGATGAT
GAAACTTGTAGAAATGGTTATAAACCCATATATTCACCAGTTACCCCAGTAACTCCTGGT
ACACCAGGAAATACCATGCACTTTGAGAATATTTCTTCCCCAGAAAGTTCTCCAGAAATA
AAGAGACGCACTTATAGTCAAGAGGGATATGACAGATCTTCAACCATGTTAACATTGGGG
CCTTTTAGAAATTCTAATTTAACTGAACTGGGTCTGCAAGAAATAAAGACTATTGGTTAT
ACGAGCCCTAGGAGTAGGACTGAAGTCAACAGGCAGTGTCCTGGAGAAAAGGAACCTGTG
TCAGACCTTCAGCTAGGACTCGATGCAGTTGAGCCAACTGCCCTACATAAAACCCTGGAA
ACGCCTGCACATGACAGGGCTGAGCCCAACAGCCAACTGGACTCGACTCACTCTGGACGG
GGCACAATGTATTCTTCCTGGGTAAAGAGCCCTGACAGAACAGGAGTTAACTTCTCAGTG
AACTCCAACTTGAGGGACCTGACACCCTCGCATCAGTTGGAGGTTGGAGGAGGCTTCCGA
ATAAGTGAGTCAAAGTGCCTGATGCAGGATGATACTAGAGGCATGTTTATGGAAACAACT
GTGTTTTGTACTTCCGAAGATGGGCTTGTATCTGGTTTCGGACGGACTGTTAATGACAAT
TTGATCGACGGGAATTGCACACCCCAGAATCCACCACAAAAGAAAAAGGTTTCTCTATTA
GAATACCGTAAGAGACAACGTGAAGCTAGGAAAAGTGGCTCTAAGACAGAGAACTTTCCA
CTCATTAGTGTATCACCCCATGCAAGTGGAAGCTTGAGCAACAATGGTGATGGCTGTGCC
AGCAGTAATGACAATGGGGAGCAGGTGGACCACACTGCTAGCCTACCTTTACCAACACCA
GCTACAGTTTATAATGCCACTTCTGAAGAAACTAGCAATAACTGCCCTGTTAAGGATGCT
ACTGCTAGTGAGAAGAATGAACCAGAAGTTCAATGGACTGCCTCAACTTCAGTGGAACAA
GTCAGAGAAAGGAGTTATCAGAGAGCTTTACTTCTCAGTGATCACCGAAAAGATAAAGAT
AGTGGGGGAGAATCACCATGTGTCTCATGTTCACCGAGTCATGTTCAGTCTTCACCTTCA
TCTCATTCAAATCACATACCCCAGTTGCAAGCTAAGGGCCCAGTCCCTTCTTTCAGTGAA
CTTATGGAAGACCCTGATCCTGAAAATCCAGAACCCACAACTACGAATGAATGTCCATCC
CCAGATACTTCTCAAAATACTTGTAAAAGTCCTCCAAAAATGAGCAAGCCTGGTTCACCT
GGATCTGTAATTCCTGCTCAAGCACACGGGAAAATATTCACAAAACCAGATCCCCAATGG
GACTCCACAGTTAGTGCATCCGAAGCTGAAAATGGTGTTCACCTAAAAACAGAGCTCCAA
CAAAAACAGCTATCAAATAACAACCAAGCACTTTCAAAGAATCATCCTCCTCAGACACAC
GTTCGTAATTCATCTGAGCAACTTTCACAAAAGCTGCCTTCTGTGCCAACAAAGTTGCAC
TGTCCTCCATCACCTCACCTAGAAAATCCTCCAAAGTCATCCACGCCTCACACACCTGTA
CAGCATGGTTATCTTTCACCAAAGCCTCCTTCACAGCAGTTAGGATCTCCCTACAGGCCT
CATCATTCACAGTCACCTCAAGTTGGAACACCTCAGCGAGAGCCTCAAAGAAACTTTTAT
CCAGCAGCACAGAACCTTCCAGCCAATACTCAGCAGGCAACTTCTGGAACATTATTTACA
CAGACACCCTCAGGACAATCTTCAGCAACATACAGTCAGTTTAACCAACAAAGTCTGAAC
AGCACGGCACCACCCCCTCCACCTCCTCCACCTCCTTCTTCGTCTTACTATCAAAACCAG
CAGCCCTCTGCAAACTTTCAGAATTATAATCAGCTCAAAGGTAGTCTTTCTCAACAAACT
GTGTTTACATCAGGACCAAATCAAGCACTTCCTGGCACCACAAGCCAGCAAACAGTTCCA
GGACACCACGTGACTCCAGGGCATTTTTTGCCCTCTCAGAACCCTACCATTCACCATCAA
ACTGCTGCTGCCGTAGTCCCCCCTCCTCCTCCACCACCACCTGCTCCAGGACCGCACCTT
GTACAACAGCCGAATTCCCATCAGCAACACTCTGTAGCACATGTAGTAGGGCCTGTTCAT
GCGGTCACCCCTGGGTCGCATATTCATTCTCAAACTGCTGGACACCACTTACCCCCACCC
CCACCCCCTCCTGGTCCTGCCCCTCATCACCATCCACCACCCCATCCATCCACAGGACTC
CAAGGTCTACAAGCACAACACCAGCATGTTGTAAATTCAGCACCCCCACCACCCCCTCCG
CCGCCACCTTCCAGTGTTTTGGCTTCTGGGCATCATACCACATCAGCTCAAGCCTTACAC
CACCCACCTCATCAAGGACCTCCACTTTTTCCTTCGAGTGCTCATCCAACTGTACCACCG
TATCCCTCACAAGCTACACATCATACCACTTTGGGACCGGGACCCCAGCACCAGCCTTCT
GGAACAGGGCCACATTGTCCATTACCTGTCACAGGTCCTCATCTCCAGCCCCAAGGACCA
AACAGTATTCCAACACCTACTGCTTCAGGGTTCTGTCCTCATCCTGGCTCTGTGGCCCTG
CCACATGGGGTTCAAGGACCTCAGCAGGCATCTCCAGTGCCTGGACAGATTCCAATTCAC
AGAGCACAGGTGCCACCAACATTTCAAAACAATTACCATGGGTCAGGGTGGCATTAA
Protein Properties
Number of Residues 1858
Molecular Weight 204963.565
Theoretical pI 7.601
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone-lysine N-methyltransferase MLL5
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
INSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDITPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPV
SDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGNCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSNNGDGCA
SSNDNGEQVDHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTNECPSPDTSQNTCKSPPKMSKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVSASEAENGVHLKTELQQKQLSNNNQALSKNHPPQTHVRNSSEQLSQKLPSVPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLPANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSSYYQNQ
QPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHHQ
TAAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPPP
PPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALH
HPPHQGPPLFPSSAHPTVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGP
NSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
GenBank ID Protein 91199543
UniProtKB/Swiss-Prot ID Q8IZD2
UniProtKB/Swiss-Prot Entry Name MLL5_HUMAN
PDB IDs
GenBank Gene ID NM_018682.3
GeneCard ID MLL5
GenAtlas ID MLL5
HGNC ID HGNC:18541
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  5. Fujiki R, Chikanishi T, Hashiba W, Ito H, Takada I, Roeder RG, Kitagawa H, Kato S: GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis. Nature. 2009 May 21;459(7245):455-9. doi: 10.1038/nature07954. Epub 2009 Apr 19. [PubMed:19377461 ]
  6. Emerling BM, Bonifas J, Kratz CP, Donovan S, Taylor BR, Green ED, Le Beau MM, Shannon KM: MLL5, a homolog of Drosophila trithorax located within a segment of chromosome band 7q22 implicated in myeloid leukemia. Oncogene. 2002 Jul 18;21(31):4849-54. [PubMed:12101424 ]
  7. Deng LW, Chiu I, Strominger JL: MLL 5 protein forms intranuclear foci, and overexpression inhibits cell cycle progression. Proc Natl Acad Sci U S A. 2004 Jan 20;101(3):757-62. Epub 2004 Jan 12. [PubMed:14718661 ]
  8. Cheng F, Liu J, Zhou SH, Wang XN, Chew JF, Deng LW: RNA interference against mixed lineage leukemia 5 resulted in cell cycle arrest. Int J Biochem Cell Biol. 2008;40(11):2472-81. doi: 10.1016/j.biocel.2008.04.012. Epub 2008 May 15. [PubMed:18573682 ]