You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09073
Secondary Accession Numbers
  • 14817
Name Sodium-dependent neutral amino acid transporter B(0)AT2
Synonyms
  1. Orphan transporter v7-3
  2. Solute carrier family 6 member 15
  3. Sodium- and chloride-dependent neurotransmitter transporter NTT73
  4. Sodium-coupled branched-chain amino-acid transporter 1
  5. Transporter v7-3
Gene Name SLC6A15
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
leucine transport
proline transport
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
neurotransmitter transporter activity
proline:sodium symporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 12
Locus 12q21.3
SNPs SLC6A15
Gene Sequence
>2193 bp
ATGCCCAAAAATAGCAAGGTGGTAAAAAGAGAATTAGATGATGATGTTACTGAGTCTGTC
AAAGACCTTCTTTCCAATGAAGACGCAGCTGATGATGCTTTTAAGACAAGTGAACTAATT
GTTGATGGCCAGGAAGAGAAAGATACAGATGTTGAAGAAGGATCTGAAGTCGAAGATGAA
AGACCAGCTTGGAACAGTAAACTACAATACATCCTGGCCCAAGTTGGATTTTCTGTAGGT
TTAGGAAATGTGTGGCGATTTCCATACCTATGTCAGAAGAATGGGGGCGGTGCATATCTT
TTACCATATTTAATACTACTTATGGTAATAGGTATTCCCCTTTTTTTCTTGGAACTCTCT
GTGGGTCAAAGAATTCGGCGAGGCAGCATTGGTGTATGGAATTACATAAGCCCTAAACTG
GGCGGGATTGGATTTGCAAGTTGTGTAGTGTGCTATTTTGTAGCTCTCTACTACAACGTC
ATCATTGGCTGGAGTTTGTTTTATTTTTCTCAGTCTTTTCAGCAACCCCTGCCTTGGGAT
CAGTGTCCTTTGGTGAAAAATGCTTCACACACTTTTGTAGAACCAGAATGTGAACAAAGT
TCTGCCACCACCTATTACTGGTACAGGGAAGCACTGAATATTTCAAGTTCCATTTCTGAA
AGTGGGGGCTTAAACTGGAAGATGACCATCTGCTTGTTGGCTGCCTGGGTCATGGTTTGC
TTGGCTATGATCAAAGGCATTCAGTCTTCTGGAAAAATCATATATTTTAGTTCTCTGTTT
CCATATGTGGTACTTATTTGCTTCCTCATCAGAGCATTCCTTTTAAATGGTTCAATTGAT
GGCATTCGCCACATGTTTACCCCTAAGCTTGAAATAATGCTGGAGCCCAAGGTCTGGAGA
GAAGCTGCTACTCAAGTGTTCTTTGCCTTAGGTCTGGGATTTGGTGGTGTCATTGCCTTT
TCAAGCTACAACAAGAGAGACAACAACTGCCACTTTGATGCTGTCCTGGTGTCCTTCATC
AATTTTTTCACTTCTGTCCTGGCAACATTGGTGGTGTTTGCAGTTCTGGGCTTCAAAGCA
AATGTCATAAATGAGAAATGCATTACACAAAATTCAGAGACGATCATGAAATTTTTGAAA
ATGGGGAACATTAGTCAGGATATTATTCCCCATCATATCAACCTTTCAACTGTTACTGCA
GAAGATTATCATTTAGTTTATGACATCATTCAAAAAGTGAAAGAAGAAGAGTTTCCTGCT
CTTCATCTCAATTCCTGTAAAATTGAAGAAGAGCTAAATAAAGCTGTTCAGGGGACCGGC
TTAGCTTTTATTGCCTTTACAGAAGCGATGACACATTTTCCTGCATCTCCCTTCTGGTCA
GTGATGTTTTTCCTCATGCTGGTCAATCTAGGCCTTGGCAGTATGTTTGGAACCATTGAA
GGGATTGTCACGCCTATTGTGGACACTTTCAAAGTGAGGAAAGAAATTCTTACTGTTATC
TGTTGTCTTCTGGCATTTTGTATTGGCCTGATATTTGTGCAACGCTCTGGAAATTACTTT
GTTACAATGTTTGATGATTATTCTGCTACACTGCCTCTGCTAATTGTAGTCATTTTGGAG
AATATTGCTGTATGCTTTGTTTATGGCATAGATAAGTTTATGGAAGACCTAAAAGATATG
CTGGGCTTTGCTCCCAGCAGATATTACTACTATATGTGGAAATATATTTCTCCTCTAATG
CTATTATCATTGCTAATAGCTAGTGTTGTGAATATGGGATTAAGTCCTCCTGGCTATAAC
GCATGGATTGAAGATAAGGCATCTGAAGAATTTCTGAGCTATCCAACATGGGGACTGGTT
GTTTGTGTCTCTCTGGTTGTCTTTGCAATACTCCCAGTCCCTGTAGTTTTCATTGTTCGT
CGCTTCAACCTTATAGATGATAGTTCTGGTAATTTAGCATCTGTGACCTATAAGAGAGGA
AGGGTCCTGAAAGAGCCTGTGAACTTAGAGGGCGATGATACAAGCCTCATTCACGGAAAA
ATACCGAGCGAGATGCCATCTCCAAATTTTGGTAAAAATATTTATCGAAAACAGAGTGGA
TCCCCAACTCTGGATACTGCTCCCAATGGACGGTATGGAATAGGGTACTTGATGGCAGAT
ATTATGCCAGATATGCCAGAATCTGATTTGTAG
Protein Properties
Number of Residues 730
Molecular Weight 69885.24
Theoretical pI 6.007
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDE
RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELS
VGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWD
QCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTICLLAAWVMVC
LAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPKLEIMLEPKVWR
EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKA
NVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIE
GIVTPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILE
NIAVCFVYGIDKFMEDLKDMLGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYN
AWIEDKASEEFLSYPTWGLVVCVSLVVFAILPVPVVFIVRRFNLIDDSSGNLASVTYKRG
RVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMAD
IMPDMPESDL
GenBank ID Protein 11907841
UniProtKB/Swiss-Prot ID Q9H2J7
UniProtKB/Swiss-Prot Entry Name S6A15_HUMAN
PDB IDs Not Available
GenBank Gene ID AF265577
GeneCard ID SLC6A15
GenAtlas ID SLC6A15
HGNC ID HGNC:13621
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Farmer MK, Robbins MJ, Medhurst AD, Campbell DA, Ellington K, Duckworth M, Brown AM, Middlemiss DN, Price GW, Pangalos MN: Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na+/Cl- -dependent neurotransmitter transporter gene family. Genomics. 2000 Dec 1;70(2):241-52. [PubMed:11112352 ]