You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09095
Secondary Accession Numbers
  • 14839
Name Solute carrier family 10 member 6
Synonyms
  1. Sodium-dependent organic anion transporter
Gene Name SLC10A6
Protein Type Unknown
Biological Properties
General Function Involved in bile acid:sodium symporter activity
Specific Function Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
organic acid:sodium symporter activity
transporter activity
bile acid:sodium symporter activity
organic acid transmembrane transporter activity
Process
sodium ion transport
establishment of localization
transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:4
Locus 4q21.3
SNPs SLC10A6
Gene Sequence
>1134 bp
ATGAGAGCCAATTGTTCCAGCAGCTCAGCCTGCCCTGCCAACAGTTCAGAGGAGGAGCTG
CCAGTGGGACTGGAGGTGCATGGAAACCTGGAGCTCGTTTTCACAGTGGTGTCCACTGTG
ATGATGGGGCTGCTCATGTTCTCTTTGGGATGTTCCGTGGAGATCCGGAAGCTGTGGTCG
CACATCAGGAGACCCTGGGGCATTGCTGTGGGACTGCTCTGCCAGTTTGGGCTCATGCCT
TTTACAGCTTATCTCCTGGCCATTAGCTTTTCTCTGAAGCCAGTCCAAGCTATTGCTGTT
CTCATCATGGGCTGCTGCCCGGGGGGCACCATCTCTAACATTTTCACCTTCTGGGTTGAT
GGAGATATGGATCTCAGCATCAGTATGACAACCTGTTCCACCGTGGCCGCCCTGGGAATG
ATGCCACTCTGCATTTATCTCTACACCTGGTCCTGGAGTCTTCAGCAGAATCTCACCATT
CCTTATCAGAACATAGGAATTACCCTTGTGTGCCTGACCATTCCTGTGGCCTTTGGTGTC
TATGTGAATTACAGATGGCCAAAACAATCCAAAATCATTCTCAAGATTGGGGCCGTTGTT
GGTGGGGTCCTCCTTCTGGTGGTCGCAGTTGCTGGTGTGGTCCTGGCGAAAGGATCTTGG
AATTCAGACATCACCCTTCTGACCATCAGTTTCATCTTTCCTTTGATTGGCCATGTCACG
GGTTTTCTGCTGGCACTTTTTACCCACCAGTCTTGGCAAAGGTGCAGGACAATTTCCTTA
GAAACTGGAGCTCAGAATATTCAGATGTGCATCACCATGCTCCAGTTATCTTTCACTGCT
GAGCACTTGGTCCAGATGTTGAGTTTCCCACTGGCCTATGGACTCTTCCAGCTGATAGAT
GGATTTCTTATTGTTGCAGCATATCAGACGTACAAGAGGAGATTGAAGAACAAACATGGA
AAAAAGAACTCAGGTTGCACAGAAGTCTGCCATACGAGGAAATCGACTTCTTCCAGAGAG
ACCAATGCCTTCTTGGAGGTGAATGAAGAAGGTGCCATCACTCCTGGGCCACCAGGGCCA
ATGGATTGCCACAGGGCTCTCGAGCCAGTTGGCCACATCACTTCATGTGAATAG
Protein Properties
Number of Residues 377
Molecular Weight 41258.2
Theoretical pI 7.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 30-50
  • 68-88
  • 98-118
  • 134-154
  • 160-180
  • 196-216
  • 227-247
  • 267-285
  • 291-311
Protein Sequence
>Solute carrier family 10 member 6
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWS
HIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVD
GDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGV
YVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVT
GFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLID
GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGP
MDCHRALEPVGHITSCE
GenBank ID Protein 35208821
UniProtKB/Swiss-Prot ID Q3KNW5
UniProtKB/Swiss-Prot Entry Name SOAT_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ583502
GeneCard ID SLC10A6
GenAtlas ID SLC10A6
HGNC ID HGNC:30603
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Geyer J, Doring B, Meerkamp K, Ugele B, Bakhiya N, Fernandes CF, Godoy JR, Glatt H, Petzinger E: Cloning and functional characterization of human sodium-dependent organic anion transporter (SLC10A6). J Biol Chem. 2007 Jul 6;282(27):19728-41. Epub 2007 May 9. [PubMed:17491011 ]