You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09102
Secondary Accession Numbers
  • 14846
Name Novel protein similar to 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (Hydroxymethylglutaricaciduria)
Synonyms
  1. SubName: Putative uncharacterized protein DKFZp434G1411
Gene Name DKFZp434G1411
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs DKFZp434G1411
Gene Sequence
>474 bp
GCCGCCCCAGGCTCCGCCATGGGGAATGTGCCATCCGCGGTGAAGCACTGCCTCAGCTAC
CAGCAGCTTCTCCGGGAGCATCTCTGGATCGGGGATTCAGTGGCAGGGGCGCTCGACCCC
GCGCAGGAAACATCCCAGTTATCTGGACTCCCTGAGTTTGTTAAAATAGTAGAAGTTGGG
CCTAGGGATGGATTGCAGAATGAAAAGGTTATAGTTCCTACAGATATAAAAATTGAATTT
ATCAATCGACTTTCCCAAACTGGCTTGTCTGTAATAGAAGTGACTAGCTTTGTGTCTTCC
AGATGGGTACCACAGGTTGCTGCTGGAGCTACTGAGATATCAGTTTTTGGAGCTGCATCT
GAATCCTTTAGCAAGAAGAATATTAACTGTTCCATTGAAGAAAGTATGGGAAAATTTGAG
GAGGTTGTTAAGTCTGCAAGACACATGAATATTCCAGCACGAGGGTACTTATGA
Protein Properties
Number of Residues 157
Molecular Weight 16899.1
Theoretical pI 5.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Novel protein similar to 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (Hydroxymethylglutaricaciduria)
AAPGSAMGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIVEVG
PRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQVAAGATEISVFGAAS
ESFSKKNINCSIEESMGKFEEVVKSARHMNIPARGYL
GenBank ID Protein 6808353
UniProtKB/Swiss-Prot ID Q9NT06
UniProtKB/Swiss-Prot Entry Name Q9NT06_HUMAN
PDB IDs Not Available
GenBank Gene ID AL137605
GeneCard ID DKFZp434G1411
GenAtlas ID DKFZp434G1411
HGNC ID HGNC:21359
References
General References Not Available