You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09109
Secondary Accession Numbers
  • 14853
Name Histone deacetylase 5
Synonyms
  1. Antigen NY-CO-9
  2. HD5
Gene Name HDAC5
Protein Type Unknown
Biological Properties
General Function Involved in histone deacetylase activity
Specific Function Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
chromatin remodeling complex
histone deacetylase complex
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
histone deacetylase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
chromatin modification
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21
SNPs HDAC5
Gene Sequence
>3369 bp
ATGAACTCTCCCAACGAGTCGGATGGGATGTCAGGTCGGGAACCATCCTTGGAAATCCTG
CCGCGGACTTCTCTGCACAGCATCCCTGTGACAGTGGAGGTGAAGCCGGTGCTGCCAAGA
GCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGG
GGGGCTCTGGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAGCTC
CTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAGAAA
CAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAG
CAGGAGATGCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAGGAG
CTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTG
GAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGC
ACTGAGGTAAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCA
GGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCTTCT
TTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTG
CCTTTGCCTGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCTGAA
CCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGTCCC
CTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATC
ACAGGTGCCGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGC
TCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAAC
ATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAG
TTCAGCCTCTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACGGTC
ACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCCGAG
AGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACA
TCCTCTATTCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGG
CATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTC
ATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGC
ATGCGGACGGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCACCG
CTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAGTTC
CTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAG
CTGCCCAGGCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAGCAG
GAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAG
AGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGAT
TGCATCCAGGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAG
GAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTGCAG
GTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAG
TCCTCCCCTGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCACCTC
TTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGGAAC
ACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAG
ACAGGCCTGCTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAGATC
CAGACAGTGCACTCTGAATACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGGCAG
AAGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCT
TGTGGGGGCATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCT
GTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAGCTC
AAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATG
GGATTCTGCTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAAC
GTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAGGCG
TTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTC
TTTCCAGGCTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTG
AACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGGAGTACCTTACAGCC
TTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCC
GCCGGGTTTGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCC
AGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTG
GCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCG
GCTCTGCTCAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAAC
ATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCAAACACTGGAGCTGT
GTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACC
GAGGAGGCCGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAG
GCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAGCCT
GCCCTGTGA
Protein Properties
Number of Residues 1122
Molecular Weight 121976.9
Theoretical pI 6.19
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Histone deacetylase 5
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
GenBank ID Protein 62750347
UniProtKB/Swiss-Prot ID Q9UQL6
UniProtKB/Swiss-Prot Entry Name HDAC5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005474.4
GeneCard ID HDAC5
GenAtlas ID HDAC5
HGNC ID HGNC:14068
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  7. Harrison BC, Huynh K, Lundgaard GL, Helmke SM, Perryman MB, McKinsey TA: Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases. FEBS Lett. 2010 Mar 19;584(6):1103-10. doi: 10.1016/j.febslet.2010.02.057. Epub 2010 Feb 24. [PubMed:20188095 ]
  8. Grozinger CM, Hassig CA, Schreiber SL: Three proteins define a class of human histone deacetylases related to yeast Hda1p. Proc Natl Acad Sci U S A. 1999 Apr 27;96(9):4868-73. [PubMed:10220385 ]
  9. McKinsey TA, Zhang CL, Olson EN: Identification of a signal-responsive nuclear export sequence in class II histone deacetylases. Mol Cell Biol. 2001 Sep;21(18):6312-21. [PubMed:11509672 ]
  10. Barrett A, Santangelo S, Tan K, Catchpole S, Roberts K, Spencer-Dene B, Hall D, Scibetta A, Burchell J, Verdin E, Freemont P, Taylor-Papadimitriou J: Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases. Int J Cancer. 2007 Jul 15;121(2):265-75. [PubMed:17373667 ]
  11. Bierne H, Tham TN, Batsche E, Dumay A, Leguillou M, Kerneis-Golsteyn S, Regnault B, Seeler JS, Muchardt C, Feunteun J, Cossart P: Human BAHD1 promotes heterochromatic gene silencing. Proc Natl Acad Sci U S A. 2009 Aug 18;106(33):13826-31. doi: 10.1073/pnas.0901259106. Epub 2009 Aug 3. [PubMed:19666599 ]
  12. Scanlan MJ, Chen YT, Williamson B, Gure AO, Stockert E, Gordan JD, Tureci O, Sahin U, Pfreundschuh M, Old LJ: Characterization of human colon cancer antigens recognized by autologous antibodies. Int J Cancer. 1998 May 29;76(5):652-8. [PubMed:9610721 ]
  13. Huynh KD, Fischle W, Verdin E, Bardwell VJ: BCoR, a novel corepressor involved in BCL-6 repression. Genes Dev. 2000 Jul 15;14(14):1810-23. [PubMed:10898795 ]
  14. Mahlknecht U, Schnittger S, Ottmann OG, Schoch C, Mosebach M, Hiddemann W, Hoelzer D: Chromosomal organization and localization of the human histone deacetylase 5 gene (HDAC5). Biochim Biophys Acta. 2000 Oct 2;1493(3):342-8. [PubMed:11018260 ]
  15. McKinsey TA, Zhang CL, Lu J, Olson EN: Signal-dependent nuclear export of a histone deacetylase regulates muscle differentiation. Nature. 2000 Nov 2;408(6808):106-11. [PubMed:11081517 ]
  16. McKinsey TA, Zhang CL, Olson EN: Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5. Proc Natl Acad Sci U S A. 2000 Dec 19;97(26):14400-5. [PubMed:11114197 ]
  17. Hook SS, Orian A, Cowley SM, Eisenman RN: Histone deacetylase 6 binds polyubiquitin through its zinc finger (PAZ domain) and copurifies with deubiquitinating enzymes. Proc Natl Acad Sci U S A. 2002 Oct 15;99(21):13425-30. Epub 2002 Sep 27. [PubMed:12354939 ]