Hmdb loader
Survey
Identification
HMDB Protein ID HMDBP09119
Secondary Accession Numbers
  • 14865
Name Gastrotropin
Synonyms
  1. Fatty acid-binding protein 6
  2. GT
  3. I-15P
  4. I-BABP
  5. ILBP
  6. Ileal lipid-binding protein
  7. Intestinal 15 kDa protein
  8. Intestinal bile acid-binding protein
Gene Name FABP6
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
transporter activity
lipid binding
Process
establishment of localization
transport
Cellular Location
  1. Isoform 2:Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q33.3-q34
SNPs FABP6
Gene Sequence
>387 bp
ATGGCTTTCACCGGCAAGTTCGAGATGGAGAGTGAGAAGAATTATGATGAGTTCATGAAG
CTCCTTGGGATCTCCAGCGATGTAATCGAAAAGGCCCGCAACTTCAAGATCGTCACGGAG
GTGCAGCAGGATGGGCAGGACTTCACTTGGTCCCAGCACTACTCCGGGGGCCACACCATG
ACCAACAAGTTCACTGTTGGCAAGGAAAGCAACATACAGACAATGGGGGGCAAGACGTTC
AAGGCCACTGTGCAGATGGAGGGCGGGAAGCTGGTGGTGAATTTCCCCAACTATCACCAG
ACCTCAGAGATCGTGGGTGACAAGCTGGTGGAGGTCTCCACCATCGGAGGCGTGACCTAT
GAGCGCGTGAGCAAGAGACTGGCCTAA
Protein Properties
Number of Residues 128
Molecular Weight 14371.2
Theoretical pI 6.81
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Gastrotropin
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA
GenBank ID Protein 4557583
UniProtKB/Swiss-Prot ID P51161
UniProtKB/Swiss-Prot Entry Name FABP6_HUMAN
PDB IDs
GenBank Gene ID NM_001445.2
GeneCard ID FABP6
GenAtlas ID FABP6
HGNC ID HGNC:3561
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  3. Oelkers P, Dawson PA: Cloning and chromosomal localization of the human ileal lipid-binding protein. Biochim Biophys Acta. 1995 Jul 13;1257(2):199-202. [PubMed:7619861 ]
  4. Fujita M, Fujii H, Kanda T, Sato E, Hatakeyama K, Ono T: Molecular cloning, expression, and characterization of a human intestinal 15-kDa protein. Eur J Biochem. 1995 Oct 15;233(2):406-13. [PubMed:7588781 ]
  5. Fang C, Dean J, Smith JW: A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma. Cancer Res. 2007 Oct 1;67(19):9039-46. [PubMed:17909007 ]
  6. Kurz M, Brachvogel V, Matter H, Stengelin S, Thuring H, Kramer W: Insights into the bile acid transportation system: the human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures. Proteins. 2003 Feb 1;50(2):312-28. [PubMed:12486725 ]