You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09175
Secondary Accession Numbers
  • 14932
Name Aflatoxin B1 aldehyde reductase member 4
Synonyms
  1. AFB1 aldehyde reductase 3
  2. AFB1-AR 3
  3. Aldoketoreductase 7-like
Gene Name AKR7L
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.13|1p35-p36.1
SNPs AKR7L
Gene Sequence
>996 bp
ATGTCCCGGCAGCTGTCGCGGGCCCGGCCAGCCACGGTGCTGGGCGCCATGGAGATGGGG
CGCCGCATGGACGCGCCCACCAGCGCCGCAGTCACGCGCGCCTTCCTGGAGCGCGGCCAC
ACCGAGATAGACACGGCCTTCCTGTACAGCGACGGCCAGTCCGAGACCATCCTTGGCGGC
CTGGGGCTCCGAATGGGCAGCAGCGACTGCAGAGTGAAAATTGCTACCAAGGCCAATCCA
TGGATTGGGAACTCCCTGAAGCCTGACAGTGTCCGATCCCAGCTGGAGACGTCACTGAAG
CGGCTGCAGTGTCCCTGAGTGGACCTCTTCTATCTACATGCACCTGACCACAGCGCCCCG
GTGGAAGAGACACTGCGTGCCTGCCACCAGCTGCACCAGGAGGGCAAGTTCGTGGAGCTT
GGCCTCTCCAACTATGCCGCCTGGGAAGTGGCCGAGATCTGTACCCTCTGCAAGAGCAAC
GGCTGGATCCTGCCCACTGTGTACCAGGGCATGTACAGCGCCACCACCCGGCAGGTGGAA
ACGGAGCTCTTCCCCTGCCTCAGGCACTTTGGACTGAGGTTCTATGCCTACAACCCTCTG
GCTGGGGGCCTGCTGACCGGCAAGTACAAGTATGAGGACAAGGACGGGAAACAGCCCGTG
GGCCGCTTCTTTGGGACTCAGTGGGCAGAGATCTACAGGAATCACTTCTGGAAGGAGCAC
CACTTCGAGGGCATTGCCCTGGTGGAGAAGGCCCTGCAGGCCGCGTATGGCGCCAGCGCT
CCCAGCATGACCTCGGCCGCCCTCCGGTGGATGTACCACCACTCACAGCTGCAGGGTGCC
CACGGGGACGCGGTCATCCTGGGCATGTCCAGCCTGGAGCAGCTGGAGCAGAACTTGGCA
GCGGCAGAGGAAGGGCCCCTGGAGCCGGCTGTCGTGGACGCCTTTAATCAAGCCTGGCAT
TTGTTTGCCCACGAATGTCCCAACTACTTCATCTAA
Protein Properties
Number of Residues 331
Molecular Weight 36963.5
Theoretical pI 6.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Aflatoxin B1 aldehyde reductase member 4
MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGG
LGLRMGSSDCRVKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPUVDLFYLHAPDHSAP
VEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVE
TELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGTQWAEIYRNHFWKEH
HFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA
AAEEGPLEPAVVDAFNQAWHLFAHECPNYFI
GenBank ID Protein 223718702
UniProtKB/Swiss-Prot ID Q8NHP1
UniProtKB/Swiss-Prot Entry Name ARK74_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_201252.3
GeneCard ID AKR7L
GenAtlas ID AKR7L
HGNC ID HGNC:24056
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Praml C, Savelyeva L, Schwab M: Aflatoxin B1 aldehyde reductase (AFAR) genes cluster at 1p35-1p36.1 in a region frequently altered in human tumour cells. Oncogene. 2003 Jul 24;22(30):4765-73. [PubMed:12879023 ]