You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09216
Secondary Accession Numbers
  • 14998
Name Cytosolic 5'-nucleotidase III-like protein
Synonyms
  1. cN-III-like protein
Gene Name NT5C3L
Protein Type Enzyme
Biological Properties
General Function Involved in magnesium ion binding
Specific Function Can act both as nucleotidase and as phosphotransferase (By similarity).
Pathways Not Available
Reactions
A 5'-ribonucleotide + Water → a ribonucleoside + Phosphoric acid details
GO Classification
Biological Process
nucleotide metabolic process
Cellular Component
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
nucleotidase activity
5'-nucleotidase activity
magnesium ion binding
Molecular Function
5'-nucleotidase activity
magnesium ion binding
transferase activity
nucleotide binding
Cellular Location
  1. Cytoplasm (Potential)
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs NT5C3L
Gene Sequence
>879 bp
ATGAAGGCCACGGTCCTGATGCGGCAGCCTGGGCGGGTGCAGGAGATCGTGGGCGCCCTC
CGCAAGGGCGGCGGAGACCGGTTACAGGTGATTTCTGATTTTGACATGACCTTGAGCAGG
TTTGCATATAATGGAAAGCGATGCCCTTCTTCTTACAATATTCTGGATAATAGCAAGATC
ATCAGTGAGGAGTGTCGGAAAGAGCTCACAGCGCTCCTTCACCACTATTACCCAATTGAG
ATCGACCCACACCGGACCGTCAAGGAGAAGCTACCTCATATGGTGGAATGGTGGACCAAA
GCGCACAATCTCCTATGTCAGCAGAAGATTCAGAAGTTTCAGATAGCCCAGGTGGTTAGA
GAGTCCAATGCAATGCTCAGGGAGGGATATAAGACCTTCTTCAACACACTCTACCATAAC
AACATTCCCCTTTTCATCTTTTCTGCGGGCATTGGTGATATCCTGGAAGAAATTATCCGA
CAGATGAAAGTGTTCCACCCCAACATCCACATCGTGTCTAACTACATGGATTTTAATGAA
GATGGTTTTCTCCAGGGATTTAAGGGCCAGCTGATACACACATACAACAAGAACAGCTCT
GTGTGTGAGAACTGTGGTTACTTCCAGCAACTTGAGGGCAAAACCAATGTCATCCTGCTG
GGAGACTCTATCGGGGACCTCACCATGGCCGATGGGGTTCCTGGTGTGCAGAACATTCTC
AAAATTGGCTTCCTGAATGACAAGGTGGAGGAGCGGCGGGAGCGCTACATGGACTCCTAT
GACATCGTGCTGGAGAAGGACGAGACTCTGGATGTGGTCAACGGGCTACTGCAGCACATC
CTGTGCCAGGGGGTCCAGCTGGAGATGCAAGGCCCCTGA
Protein Properties
Number of Residues 292
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic 5'-nucleotidase III-like protein
MKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKI
ISEECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVR
ESNAMLREGYKTFFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNE
DGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNVILLGDSIGDLTMADGVPGVQNIL
KIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP
GenBank ID Protein 54035066
UniProtKB/Swiss-Prot ID Q969T7
UniProtKB/Swiss-Prot Entry Name 5NT3L_HUMAN
PDB IDs Not Available
GenBank Gene ID BC013742
GeneCard ID NT5C3L
GenAtlas ID NT5C3L
HGNC ID HGNC:28300
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]