You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09217
Secondary Accession Numbers
  • 14999
Name Probable gluconokinase
Synonyms
  1. Gluconate kinase
Gene Name IDNK
Protein Type Enzyme
Biological Properties
General Function Involved in shikimate kinase activity
Specific Function Not Available
Pathways
  • D-gluconate degradation
Reactions
Adenosine triphosphate + Gluconic acid → ADP + 6-Phosphogluconic acid details
GO Classification
Biological Process
D-gluconate catabolic process
Cellular Component
cytoplasm
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
shikimate kinase activity
Molecular Function
ATP binding
gluconokinase activity
shikimate kinase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q21.32
SNPs C9orf103
Gene Sequence
>564 bp
ATGGCGGCGCCGGGCGCGCTGCTGGTGATGGGCGTGAGCGGCTCGGGGAAATCCACCGTG
GGCGCCCTGCTGGCATCTGAGCTGGGATGGAAATTCTATGATGCTGATGATTATCACCCG
GAGGAAAATCGAAGGAAGATGGGAAAAGGCATACCGCTCAATGACCAGGACCGGATTCCA
TGGCTCTGTAACTTGCATGACATTTTACTAAGAGATGTAGCCTCGGGACAGCGTGTGGTT
CTAGCCTGTTCAGCCCTGAAGAAAACGTACAGAGACATATTAACACAAGGAAAAGATGGT
GTAGCTCTGAAGTGTGAGGAGTCGGGAAAGGAAGCAAAGCAGGCTGAGATGCAGCTCCTG
GTGGTCCATCTGAGCGGGTCGTTTGAGGTCATCTCTGGACGCTTACTCAAAAGAGAGGGA
CATTTTATGCCCCCTGAATTATTGCAGTCCCAGTTTGAGACTCTGGAGCCCCCAGCAGCT
CCAGAAAACTTTATCCAAATAAGTGTGGACAAAAATGTTTCAGAGATAATTGCTACAATT
ATGGAAACCCTAAAAATGAAATGA
Protein Properties
Number of Residues 187
Molecular Weight 20577.63
Theoretical pI 6.207
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable gluconokinase
MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIP
WLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLL
VVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATI
METLKMK
GenBank ID Protein 55958667
UniProtKB/Swiss-Prot ID Q5T6J7
UniProtKB/Swiss-Prot Entry Name GNTK_HUMAN
PDB IDs Not Available
GenBank Gene ID AL354920
GeneCard ID C9orf103
GenAtlas ID C9orf103
HGNC ID HGNC:31367
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Sweetser DA, Peniket AJ, Haaland C, Blomberg AA, Zhang Y, Zaidi ST, Dayyani F, Zhao Z, Heerema NA, Boultwood J, Dewald GW, Paietta E, Slovak ML, Willman CL, Wainscoat JS, Bernstein ID, Daly SB: Delineation of the minimal commonly deleted segment and identification of candidate tumor-suppressor genes in del(9q) acute myeloid leukemia. Genes Chromosomes Cancer. 2005 Nov;44(3):279-91. [PubMed:16015647 ]