You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09248
Secondary Accession Numbers
  • 15074
Name Probable threonine--tRNA ligase 2, cytoplasmic
Synonyms
  1. ThrRS
  2. Threonine--tRNA ligase
  3. Threonyl-tRNA synthetase-like protein 2
  4. Threonyl-tRNA synthetase
Gene Name TARSL2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Not Available
Pathways
  • Aminoacyl-tRNA biosynthesis
Reactions
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-threonyl-tRNA(Thr) details
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-Threonyl-tRNA(Thr) details
GO Classification
Biological Process
threonyl-tRNA aminoacylation
Cellular Component
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
threonine-trna ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-trna and related compounds
aminoacyl-trna ligase activity
Molecular Function
ATP binding
threonine-tRNA ligase activity
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna aminoacylation
trna aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
threonyl-trna aminoacylation
biosynthetic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 15
Locus 15q26.3
SNPs TARSL2
Gene Sequence
>2409 bp
ATGGCGGCCGAGGCCCTGGCGGCGGAGGCCGTGGCGTCGCGCCTGGAGCGGCAGGAGGAG
GACATCCGCTGGCTGTGGTCGGAGGTCGAGCGCCTGAGGGACGAGCAGCTGAACGCGCCC
TACAGCTGCCAGGCGGAGGGGCCGTGCCTCACGCGGGAGGTGGCGCAGCTCCGGGCCGAG
AACTGCGACCTGCGCCACCGCCTGTGCAGCCTGCGGCTGTGCCTCGCCGAGGAGCGGAGC
CGCCAGGCCACGCTGGAGAGCGCGGAGCTAGAGGCGGCGCAGGAGGCCGGCGCACAGCCT
CCTCCTAGTCAAAGCCAAGACAAGGACATGAAAAAGAAGAAAATGAAGGAAAGCGAGGCT
GACAGCGAGGTGAAGCATCAACCAATTTTCATAAAAGAAAGATTGAAGCTTTTTGAAATA
CTGAAGAAAGACCATCAGCTCTTACTTGCCATTTATGGAAAAAAGGGGGATACAAGCAAC
ATCATCACAGTAAGAGTGGCTGATGGGCAAACAGTGCAAGGGGAAGTCTGGAAAACAACG
CCTTACCAAGTGGCTGCTGAAATTAGTCAGGAACTGGCTGAAAGCACGGTAATAGCCAAA
GTCAATGGTGAACTGTGGGACCTGGACCGCCCATTGGAAGGGGACTCTTCTCTAGAGCTG
CTTACATTTGATAATGAGGAAGCTCAAGCTGTGTACTGGCACTCCAGTGCTCACATTCTT
GGGGAGGCCATGGAGCTTTACTATGGAGGCCACCTGTGCTACGGTCCGCCCATTGAAAAT
GGATTTTATTATGACATGTTCATTGAAGACAGAGCAGTGTCCAGCACAGAATTGTCAGCC
CTGGAGAATATATGTAAAGCCATCATAAAAGAAAAGCAACCTTTTGAAAGACTAGAAGTC
AGCAAGGAAATCCTCCTGGAAATGTTTAAGTACAATAAATTTAAATGCCGCATTCTGAAT
GAGAAAGTTAACACTGCAACTACCACCGTGTACAGGTGCGGTCCATTAATTGACCTTTGC
AAAGGTCCACATGTAAGACACACTGGAAAAATTAAAACCATCAAAATTTTTAAGAATTCC
TCAACATATTGGGAGGGCAATCCGGAAATGGAAACATTGCAGAGGATCTATGGAATATCC
TTTCCTGATAACAAGATGATGAGAGACTGGGAAAAGTTCCAAGAGGAAGCAAAGAACCGA
GATCACAGGAAGATCGGGAAGGAACAAGAACTTTTCTTTTTCCACGATTTGAGTCCTGGA
AGCTGTTTTTTCCTTCCCAGAGGAGCCTTCATTTATAATACGCTTACAGATTTCATACGA
GAGGAATATCACAAACGGGACTTCACGGAGGTGCTCTCTCCCAATATGTACAACAGTAAA
CTCTGGGAAGCCTCAGGCCACTGGCAGCATTACAGCGAGAACATGTTTACCTTTGAGATT
GAAAAGGACACTTTTGCCCTCAAACCCATGAATTGTCCAGGGCACTGTCTAATGTTTGCC
CATCGTCCACGATCTTGGAGGGAAATGCCTATTAGATTTGCTGATTTTGGAGTTCTGCAT
AGAAATGAACTGTCGGGGACTCTCAGCGGCTTGACCAGAGTGAGGCGCTTCCAGCAGGAC
GATGCTCACATTTTTTGCACAGTGGAGCAGATTGAAGAAGAAATAAAGGGGTGTTTGCAG
TTTTTGCAATCTGTTTACTCAACATTTGGCTTCTCCTTTCAATTAAACCTGTCAACAAGG
CCGGAAAACTTCCTAGGAGAGATTGAGATGTGGAATGAGGCTGAGAAGCAACTGCAGAAC
AGCTTGATGGACTTTGGAGAACCGTGGAAAATGAACCCAGGAGATGGAGCATTTTATGGC
CCTAAAATTGACATAAAAATCAAGGATGCTATTGGCAGATACCATCAATGTGCTACAATT
CAGCTGGACTTCCAACTGCCTATTAGATTTAATCTCACATATGTTAGTAAGGATGGGGAT
GATAAGAAGAGACCTGTGATCATTCATCGAGCCATTTTGGGATCAGTGGAAAGAATGATA
GCCATTCTTTCAGAAAACTATGGCGGAAAATGGCCTTTCTGGCTATCTCCTCGTCAGGTG
ATGGTCATCCCTGTGGGGCCAACTTGTGAAAAATATGCACTTCAGGTATCCAGTGAATTT
TTTGAAGAAGGATTTATGGCTGACGTTGACTTGGATCACAGTTGTACACTAAATAAGAAA
ATACGAAATGCACAGCTGGCTCAGTATAATTTTATTTTGGTGGTTGGAGAAAAGGAAAAG
ATAGATAATGCTGTAAACGTGCGAACAAGAGACAACAAAATTCATGGAGAGATTTTAGTA
ACTTCTGCCATTGATAAACTGAAGAATCTCAGGAAGACACGGACACTCAATGCTGAGGAG
GCCTTTTGA
Protein Properties
Number of Residues 802
Molecular Weight 92644.755
Theoretical pI 6.054
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable threonyl-tRNA synthetase 2, cytoplasmic
MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NCDLRHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEA
DSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTT
PYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHIL
GEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEV
SKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNS
STYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEI
EKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQD
DAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQN
SLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGD
DKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEF
FEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTRDNKIHGEILV
TSAIDKLKNLRKTRTLNAEEAF
GenBank ID Protein 38570111
UniProtKB/Swiss-Prot ID A2RTX5
UniProtKB/Swiss-Prot Entry Name SYTC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_152334.2
GeneCard ID TARSL2
GenAtlas ID TARSL2
HGNC ID HGNC:24728
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]