You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09257
Secondary Accession Numbers
  • 15085
Name E3 ubiquitin-protein ligase HUWE1
Synonyms
  1. ARF-BP1
  2. ARF-binding protein 1
  3. HECT, UBA and WWE domain-containing protein 1
  4. HectH9
  5. Homologous to E6AP carboxyl terminus homologous protein 9
  6. LASU1
  7. Large structure of UREB1
  8. Mcl-1 ubiquitin ligase E3
  9. Mule
  10. URE-B1
  11. URE-binding protein 1
  12. Upstream regulatory element-binding protein 1
Gene Name HUWE1
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins. Regulates apoptosis by catalyzing the polyubiquitination and degradation of MCL1. Also ubiquitinates the p53 tumor suppressor and core histones including H1, H2A, H2B, H3 and H4. Binds to an upstream initiator-like sequence in the preprodynorphin gene. Regulates neural differentiation and proliferation by catalyzing the polyubiquitination and degradation of MYCN. May regulate abundance of CDC6 after DNA damage by polyubiquitinating and targeting CDC6 to degradation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs HUWE1
Gene Sequence
>13125 bp
ATGAAAGTAGACAGGACTAAACTGAAGAAGACACCTACTGAGGCTCCTGCAGACTGCAGA
GCCTTAATAGACAAACTCAAAGTTTGTAATGATGAGCAACTTCTCTTGGAACTGCAGCAG
ATCAAAACATGGAACATTGGAAAGTGCGAGTTATATCACTGGGTGGACCTGTTGGACCGC
TTCGATGGAATACTGGCAGATGCTGGACAGACAGTGGAGAATATGTCATGGATGCTCGTA
TGTGATAGGCCAGAAAGAGAGCAACTGAAAATGCTTCTCTTGGCTGTGTTGAACTTCACA
GCCTTGCTCATTGAGTACAGCTTTTCCCGGCATCTGTACAGTTCCATAGAGCATTTGACA
ACTTTATTGGCTTCCTCTGATATGCAAGTGGTGCTGGCAGTCCTCAATCTCCTATATGTA
TTTAGCAAAAGATCAAACTACATCACTCGTCTGGGATCTGACAAGAGGACCCCGCTGCTA
ACTCGGCTACAACATTTGGCAGAGAGCTGGGGTGGAAAGGAGAATGGCTTTGGACTTGCA
GAATGTTGCAGAGACTTGCATATGATGAAATATCCACCCAGTGCAACTACACTACACTTT
GAATTCTATGCAGATCCTGGGGCCGAGGTCAAAATTGAGAAAAGGACAACTAGTAACACA
CTACATTATATTCACATAGAGCAACTTGACAAGATTTCAGAAAGCCCTTCTGAAATCATG
GAATCTCTTACCAAAATGTACAGCATTCCTAAGGATAAGCAGATGCTGTTATTTACACAC
ATACGACTGGCCCATGGCTTTTCTAATCACAGGAAGCGATTGCAGGCAGTTCAGGCCAGA
CTGCATGCAATATCTATATTAGTGTATTCCAATGCCTTGCAGGAATCAGCAAACAGTATC
TTGTATAATGGCTTGATAGAGGAGTTGGTAGATGTCCTTCAGATAACGGATAAGCAGCTT
ATGGAGATTAAAGCAGCTTCTTTACGAACATTAACATCAATTGTCCACTTGGAGAGAACT
CCCAAACTCAGCAGTATTATTGACTGTACTGGAACTGCCTCCTACCATGGATTTTTGCCA
GTGCTTGTAAGGAACTGTATCCAGGCCATGATTGATCCTTCCATGGATCCATACCCTCAC
CAGTTTGCCACTGCTCTCTTCTCTTTTTTATACCATCTGGCCAGCTACGATGCTGGTGGT
GAAGCCTTGGTCTCCTGTGGAATGATGGAAGCCTTATTGAAGGTCATAAAGTTTCTTGGC
GATGAACAGGACCAGATAACATTTGTCACCAGAGCCGTCAGAGTGGTTGACCTTATCACC
AACCTGGATATGGCAGCTTTTCAATCCCATAGTGGACTTTCTATCTTCATTTATAGACTT
GAGCATGAAGTAGATTTGTGCCGAAAAGAATGTCCGTTTGTGATCAAGCCAAAGATCCAG
AGACCCAATACTACACAAGAAGGAGAGGAAATGGAAACTGATATGGATGGAGTCCAGTGT
ATTCCACAACGAGCAGCACTTCTGAAATCCATGTTGAATTTCCTCAAGAAGGCCATCCAA
GACCCTGCTTTCTCAGATGGCATACGACATGTGATGGATGGTTCTCTGCCTACCTCCCTG
AAACACATCATCAGCAATGCAGAATACTATGGCCCATCACTCTTCCTCCTAGCTACTGAA
GTGGTGACTGTGTTTGTATTTCAAGAACCATCACTGCTCTCCTCACTCCAGGACAATGGA
TTGACAGATGTCATGCTGCATGCACTGCTTATCAAAGATGTTCCTGCTACCCGTGAAGTC
CTTGGCTCCCTCCCAAATGTATTCAGTGCACTCTGTTTGAATGCCCGAGGTCTTCAGTCT
TTTGTTCAGTGTCAGCCTTTTGAACGCCTCTTCAAAGTTCTTCTGTCTCCAGATTACCTC
CCAGCCATGCGGAGGAGGAGAAGTTCTGATCCCCTTGGGGATACTGCATCCAACCTGGGG
AGTGCTGTCGATGAGCTCATGAGACATCAGCCCACCCTTAAAACAGATGCAACGACTGCC
ATCATCAAGTTACTTGAAGAAATCTGTAATCTTGGAAGGGACCCCAAATACATCTGTCAG
AAGCCATCAATCCAGAAGGCAGATGGCACTGCCACTGCTCCTCCCCCAAGGTCTAATCAT
GCCGCAGAAGAAGCCTCTAGTGAGGATGAGGAGGAAGAGGAAGTACAGGCCATGCAGAGC
TTTAATTCTACCCAGCAAAATGAAACTGAGCCTAATCAGCAGGTTGTTGGTACAGAGGAA
CGTATTCCTATTCCCCTCATGGATTACATCCTTAATGTGATGAAATTTGTGGAATCTATT
CTGAGCAACAATACAACAGATGACCACTGCCAGGAATTTGTGAATCAGAAAGGACTGTTG
CCTTTGGTTACCATTTTGGGTCTTCCCAATCTGCCCATTGACTTTCCCACATCTGCTGCC
TGTCAGGCTGTTGCAGGTGTCTGCAAATCCATATTGACACTGTCACATGAACCCAAAGTC
CTTCAAGAGGGTCTCCTTCAGTTGGACTCCATCCTCTCCTCCCTGGAGCCCTTACACCGC
CCCATTGAATCCCCTGGGGGCTCAGTGTTGTTGCGAGAACTGGCTTGCGCAGGCAATGTT
GCTGATGCTACCCTCTCAGCCCAGGCCACACCTCTGCTGCATGCACTCACTGCTGCCCAT
GCCTACATCATGATGTTTGTTCATACTTGCAGAGTTGGACAGAGTGAAATTCGTTCCATC
TCCGTAAACCAGTGGGGCTCTCAATTGGGTCTGAGTGTTTTGAGCAAGCTGAGCCAGTTA
TACTGTTCCCTGGTGTGGGAAAGCACTGTCCTCCTCTCTCTGTGTACCCCAAACAGCCTA
CCATCTGGGTGTGAATTTGGCCAGGCAGATATGCAGAAACTGGTTCCAAAGGATGAGAAG
GCAGGTACGACCCAGGGCGGAAAAAGATCAGATGGGGAACAGGATGGAGCAGCTGGAAGT
ATGGATGCTTCTACCCAGGGCTTATTAGAAGGCATTGGGCTAGATGGTGACACATTGGCT
CCCATGGAGACAGATGAACCTACTGCTTCAGACTCTAAGGGCAAATCTAAAATCACACCA
GCAATGGCTGCCAGAATTAAGCAAATCAAGCCTTTGTTATCAGCTTCCTCCAGATTAGGC
CGAGCACTTGCTGAGCTATTTGGACTTCTTGTTAAACTTTGTGTGGGATCTCCTGTCCGC
CAGAGAAGGAGCCATCATGCTGCCAGCACCACTACAGCACCGACACCTGCCGCGCGATCA
ACAGCCTCAGCTCTCACTAAGCTCTTGACTAAGGGGTTATCTTGGCAGCCCCCACCATAT
ACACCTACTCCCCGATTCAGGCTGACATTCTTCATCTGTTCAGTTGGTTTCACATCCCCA
ATGCTGTTTGATGAGAGGAAGTATCCCTACCACCTCATGCTGCAAAAATTTCTCTGCTCC
GGAGGCCACAATGCTCTTTTTGAAACTTTCAACTGGGCTCTGTCCATGGGAGGTAAAGTT
CCTGTTTCTGAGGGATTGGAACACTCAGACTTGCCTGATGGCACAGGAGAATTCCTAGAT
GCCTGGCTTATGCTGGTGGAGAAGATGGTGAATCCCACCACGGTGCTTGAATCTCCACAT
TCGCTGCCTGCCAAATTGCCTGGAGGTGTCCAGAACTTTCCCCAGTTCAGTGCACTGCGC
TTCCTTGTGGTAACTCAGAAAGCAGCCTTTACTTGCATCAAAAACTTATGGAACCGGAAA
CCCCTGAAGGTATATGGTGGACGAATGGCTGAATCGATGCTGGCCATTCTATGCCACATC
CTCCGAGGAGAACCTGTGATTCGAGAGAGACTAAGCAAGGAGAAGGAGGGGTCTCGAGGA
GAAGAGGATACAGGGCAAGAGGAAGGTGGCTCCCGCCGGGAACCTCAAGTCAACCAGCAA
CAACTGCAACAGCTCATGGACATGGGCTTCACAAGGGAACATGCAATGGAGGCACTGTTG
AACACCAGCACCATGGAGCAGGCCACAGAGTACCTTTTAACCCACCCTCCTCCAATCATG
GGAGGAGTTGTTCGGGATCTCAGCATGTCTGAAGAGGACCAGATGATGAGAGCAATTGCT
ATGTCTCTGGGACAGGATATTCCAATGGATCAAAGGGCAGAGTCACCTGAGGAAGTTGCT
TGCCGGAAGGAGGAAGAGGAACGGAAAGCTCGGGAAAAGCAGGAGGAGGAAGAGGCTAAA
TGTCTAGAGAAGTTCCAGGATGCTGACCCGTTGGAACAAGATGAGCTCCACACTTTCACA
GATACTATGTTGCCAGGCTGCTTCCACCTTCTTGATGAGCTGCCAGACACAGTATACCGT
GTGTGTGACCTGATCATGACAGCAATCAAACGTAATGGAGCAGATTATCGTGACATGATT
CTGAAGCAAGTAGTCAATCAGGTGTGGGAAGCTGCTGATGTATTGATCAAAGCTGCTCTT
CCCCTGACAACAAGTGACACAAAAACCGTGTCAGAGTGGATAAGTCAGATGGCCACACTG
CCCCAGGCCTCCAATTTGGCTACTAGAATCTTGCTTTTAACGCTACTTTTTGAGGAGTTG
AAGCTACCTTGTGCTTGGGTGGTTGAATCAAGTGGCATCCTTAATGTCCTAATCAAACTC
TTGGAAGTGGTTCAGCCCTGCCTCCAGGCAGCCAAGGAGCAGAAGGAAGTCCAGACCCCA
AAGTGGATCACACCAGTGTTGCTCCTGATTGATTTCTATGAAAAGACAGCCATCTCCTCA
AAAAGGAGAGCCCAGATGACTAAGTACCTGCAATCCAACAGCAACAACTGGCGCTGGTTT
GATGATCGCTCTGGGCGTTGGTGTAGTTACAGTGCAAGCAACAATAGCACTATTGATTCT
GCCTGGAAATCTGGAGAGACAAGCGTGCGATTCACTGCAGGCCGAAGAAGATACACGGTC
CAATTCACTACAATGGTGCAGGTTAATGAGGAAACAGGGAACCGACGCCCTGTGATGCTG
ACTCTCCTCAGGGTACCTCGGCTGAATAAAAATTCAAAAAACAGCAATGGACAGGAACTA
GAGAAGACGCTGGAAGAAAGCAAAGAAATGGATATCAAACGTAAAGAAAATAAAGGCAAT
GATACCCCTTTGGCCCTAGAGAGTACAAACACTGAAAAGGAGACAAGCCTGGAGGAAACA
AAAATCGGGGAGATCCTGATCCAGGGCTTGACAGAAGATATGGTGACTGTTTTAATCCGG
GCCTGCGTGAGCATGCTGGGAGTCCCTGTGGACCCAGATACTTTGCATGCCACCCTTCGT
CTCTGTCTGAGGCTCACCCGGGACCACAAATATGCCATGATGTTTGCAGAACTGAAGAGT
ACCCGCATGATCTTGAATTTGACCCAGAGCTCAGGCTTCAATGGGTTTACTCCCCTGGTC
ACCCTTCTCTTAAGACACATCATTGAGGACCCCTGTACCCTTCGTCATACCATGGAAAAG
GTTGTTCGCTCAGCAGCTACAAGTGGAGCTGGTAGCACTACCTCTGGTGTTGTGTCTGGC
AGCCTCGGCTCTCGGGAGATCAACTACATCCTTCGTGTCCTTGGGCCAGCCGCATGCCGC
AATCCAGACATATTCACAGAAGTGGCCAACTGCTGTATCCGCATCGCCCTTCCTGCCCCT
CGAGGCTCAGGAACTGCTTCAGATGATGAATTTGAGAATCTTAGAATTAAAGGCCCTAAT
GCTGTACAGCTGGTGAAGACCACCCCTTTGAAGCCCTCACCTCTGCCTGTCATCCCTGAT
ACTATCAAGGAAGTGATCTATGATATGCTGAATGCTCTGGCTGCATACCATGCTCCAGAG
GAAGCAGATAAATCTGATCCTAAACCTGGGGTTATGACCCAAGAGGTTGGCCAGCTCCTG
CAAGACATGGGTGATGATGTATACCAGCAGTACCGGTCACTTACGCGTCAGAGCAGTGAC
TTTGATACGCAGTCAGGTTTTTCCATTAATAGTCAGGTCTTTGCTGCAGATGGTGCCTCC
ACTGAGACTTCCGCATCTGGGACCTCCCAAGGAGAGGCTTCAACTCCAGAGGAGTCTCGA
GATGGGAAGAAAGATAAAGAAGGGGACCGGGCCTCTGAGGAAGGCAAACAGAAAGGCAAG
GGCAGCAAACCTTTAATGCCTACCTCCACTATCCTTCGTCTTCTGGCAGAGTTGGTGAGG
TCCTATGTTGGTATTGCTACCCTGATTGCCAACTACAGCTACACTGTGGGCCAGTCTGAA
CTGATCAAAGAGGACTGCAGTGTGCTAGCTTTTGTTCTGGACCACCTGCTCCCACATACC
CAGAATGCAGAAGACAAGGACACCCCTGCCTTGGCCCGCCTGTTCCTCGCAAGCCTGGCT
GCTGCAGGGAGTGGCACAGATGCCCAGGTGGCCCTAGTGAATGAAGTAAAAGCAGCCCTT
GGACGGGCACTGGCTATGGCTGAGAGTACAGAGAAACATGCCAGGCTTCAGGCAGTGATG
TGTATCATCAGTACTATCATGGAGTCCTGCCCCTCCACCTCCAGCTTCTACAGCAGTGCC
ACAGCGAAGACCCAGCACAATGGCATGAACAACATCATTCGGCTTTTCCTGAAGAAGGGA
CTGGTTAATGACCTGGCCAGAGTACCTCACAGCTTAGACCTGTCCAGTCCCAACATGGCC
AACACAGTCAATGCTGCTCTGAAGCCTTTGGAAACACTTTCCCGGATTGTGAACCAGCCC
AGTAGCCTTTTTGGCAGCAAGAGTGCTTCTAGCAAGAACAAGTCTGAGCAGGATGCCCAA
GGAGCCTCTCAAGATTCCAGTAGCAACCAGCAGGACCCAGGCGAGCCTGGGGAAGCAGAA
GTGCAGGAGGAGGATCATGATGTCACTCAGACAGAGGTGGCAGATGGGGATATCATGGAT
GGGGAGGCTGAAACCGACTCAGTGGTGATTGCTGGGCAGCCTGAGGTGCTCAGTTCACAA
GAGATGCAGGTTGAGAATGAGCTGGAGGACCTGATAGATGAGTTGCTTGAGAGGGATGGC
GGATCTGGGAACAGTACAATTATAGTGAGCAGAAGTGGAGAGGATGAATCACAAGAGGAC
GTGCTGATGGATGAAGCTCCTTCCAACCTCAGCCAAGCTTCCACCTTGCAGGCCAACCGA
GAAGATTCCATGAATATCCTGGACCCTGAGGATGAGGAGGAGCACACTCAGGAAGAGGAC
AGCAGTGGCAGTAACGAGGATGAGGATGATAGTCAGGATGAAGAGGAGGAGGAGGAGGAA
GATGAGGAAGATGATCAGGAGGATGATGAAGGTGAAGAGGGAGATGAAGACGATGACGAC
GATGGCTCTGAGATGGAATTGGATGAGGATTATCCTGATATGAACGCTTCTCCCTTGGTC
CGATTTGAGCGCTTTGACCGGGAGGATGATCTCATCATTGAGTTTGACAACATGTTCTCC
AGTGCTACAGACATCCCCCCATCCCCAGGAAATATCCCTACCACCCATCCACTGATGGTG
CGCCATGCAGACCACAGTTCTCTGACACTGGGCAGTGGCTCTTCAACAACTCGTCTCACC
CAGGGCATCGGGCGCAGTCAGAGGACCCTAAGGCAGCTGACGGCCAATACTGGCCACACC
ATTCATGTTCACTACCCTGGGAATCGCCAGCCCAACCCTCCTCTTATACTGCAGAGGTTG
CTTGGTCCCTCAGCTGCTGCTGACATCCTTCAGCTGAGCAGCAGCCTTCCCCTACAAAGC
CGGGGTCGGGCCCGCCTCCTGGTAGGCAACGATGACGTCCACATCATCGCCCGTTCTGAT
GATGAGCTGCTGGATGACTTTTTCCATGATCAGAGCACAGCTACCAGCCAAGCAGGAACC
CTGTCCAGCATCCCCACAGCCCTGACCCGCTGGACAGAAGAATGCAAAGTTCTCGATGCT
GAGAGCATGCATGACTGTGTTTCAGTGGTTAAAGTGTCCATTGTCAATCACCTGGAATTC
CTGAGGGATGAGGAGCTGGAAGAAAGGCGAGAGAAGCGCAGGAAACAACTGGCTGAGGAA
GAAACAAAGATAACTGATAAAGGCAAAGAAGATAAGGAGAACAGGGATCAGAGTGCACAG
TGTACTGCATCTAAGTCAAATGACTCCACTGAACAGAATCTCTCAGATGGGACGCCTATG
CCTGACAGCTACCCAACAACCCCATCTTCAACTGATGCAGCTACATCTGAGTCCAAGGAG
ACCCTTGGCACTCTGCAATCCTCACAACAGCAACCAACACTCCCAACCCCACCAGCTTTG
GGAGAGGTTCCTCAGGAGCTGCAGTCTCCAGCTGGAGAAGGGGGCAGCTCTACACAGCTA
TTGATGCCTGTAGAGCCAGAGGAATTGGGTCCCACAAGGCCAAGTGGGGAAGCAGAAACA
ACTCAGATGGAGTTATCCCCAGCTCCCACTATAACCTCACTTTCCCCAGAGAGAGCTGAG
GATTCTGATGCACTGACGGCTGTCAGCAGTCAGCTAGAAGGCTCTCCTATGGATACAAGC
AGCCTGGCTTCCTGTACCTTAGAGGAGGCTGTGGGTGACACTTCAGCAGCTGGCAGTTCT
GAGCAGCCCAGAGCAGGCAGCTCCACTCCTGGGGATGCCCCACCAGCTGTGGCGGAAGTG
CAAGGCAGGAGTGATGGGTCAGGGGAATCTGCCCAGCCACCTGAGGACAGCTCCCCACCT
GCATCCTCTGAGAGCTCTTCCACCAGAGATTCTGCCGTGGCCATTTCTGGAGCAGATTCC
CGAGGAATCCTAGAAGAGCCGTTGCCTTCAACAAGCAGTGAAGAAGAAGATCCCCTTGCG
GGTATCAGTCTCCCTGAAGGTGTGGACCCCTCTTTTCTGGCTGCCCTGCCTGATGACATC
CGTCGGGAAGTTCTACAGAACCAGCTAGGCATTCGTCCACCAACCCGGACTGCCCCCTCC
ACAAATAGCTCAGCGCCTGCAGTGGTGGGGAATCCTGGTGTGACTGAAGTGAGCCCTGAG
TTTCTGGCTGCCCTGCCTCCAGCCATTCAGGAGGAAGTACTGGCACAGCAGAGAGCTGAG
CAGCAGCGACGAGAACTAGCACAGAATGCCAGCTCAGACACCCCTATGGACCCTGTGACC
TTCATCCAGACTCTGCCCTCAGACCTGCGCCGTAGTGTCCTAGAGGATATGGAGGACAGT
GTGTTAGCTGTGATGCCACCTGACATTGCAGCTGAGGCTCAAGCCCTGAGACGAGAGCAA
GAAGCCCGGCAGCGACAGCTCATGCATGAGCGTCTGTTTGGGCACAGTAGCACCTCCGCA
CTCTCTGCTATTCTCCGAAGCCCGGCTTTCACCAGTCGCTTAAGTGGCAACCGTGGGGTC
CAGTATACTCGCCTTGCTGTGCAGAGAGGTGGCACCTTCCAGATGGGGGGTAGCAGCAGC
CATAACAGGCCTTCTGGCAGTAATGTAGATACTCTCCTCCGCCTCCGAGGACGGCTCCTT
CTGGACCACGAAGCCCTTTCTTGTCTCTTGGTCCTACTTTTTGTGGATGAGCCAAAGCTC
AATACTAGCCGTCTACACCGAGTACTGAGAAATCTCTGCTACCATGCCCAGACCCGCCAC
TGGGTCATCCGCAGTCTGCTCTCCATCTTGCAGCGCAGCAGTGAGAGTGAGCTATGCATT
GAAACACCCAAACTCACTACAAGTGAGGAAAAGGGCAAAAAGTCGAGCAAGAGCTGTGGG
TCAAGTAGCCATGAGAACCGTCCCCTGGACCTGCTACACAAGATGGAGTCAAAGAGCTCC
AACCAGCTTTCCTGGCTCTCAGTATCCATGGATGCAGCCCTAGGCTGCAGGACTAATATA
TTTCAGATCCAGCGTTCAGGGGGGCGTAAACATACCGAGAAGCATGCAAGCGGTGGCTCC
ACCGTCCACATCCATCCCCAAGCTGCTCCTGTTGTCTGCAGACACGTTTTGGATACACTC
ATTCAATTGGCCAAGGTATTTCCCAGCCACTTCACACAGCAGCGGACCAAAGAAACAAAC
TGTGAGAGTGATCGGGAAAGGGGCAATAAGGCCTGTAGCCCATGCTCCTCACAGTCCTCC
AGCAGTGGCATTTGCACAGACTTCTGGGACTTATTGGTAAAACTGGACAACATGAATGTC
AGCCGGAAAGGCAAGAACTCCGTGAAGTCAGTGCCAGTGAGCGCTGGCGGTGAGGGGGAA
ACCTCTCCATACAGCCTCGAGGCCTCTCCACTGGGGCAGCTCATGAACATGTTGTCACAC
CCAGTCATCCGCCGGAGCTCTCTCTTAACTGAGAAACTCCTCAGACTCCTTTCTCTCATC
TCAATTGCTCTCCCAGAAAACAAGGTGTCAGAAGCACAGGCTAATTCTGGCAGCGGTGCT
TCCTCCACCACCACTGCCACCTCAACCACATCTACCACCACCACCACTGCCGCCTCCACC
ACGCCCACACCCCCTACTGCACCCACCCCTGTCACTTCTGCTCCAGCCCTGGTTGCTGCC
ACGGCTATTTCCACCATTGTCGTAGCTGCTTCGACCACAGTGACTACCCCCACGACTGCT
ACCACTACTGTTTCAATTTCTCCCACTACTAAGGGCAGCAAATCTCCAGCGAAGGTGAGT
GATGGGGGCAGCAGCAGTACAGACTTTAAGATGGTGTCCTCTGGCCTCACTGAAAACCAG
CTACAGCTCTCTGTAGAGGTGTTGACATCCCACTCTTGTTCTGAGGAAGGCTTAGAGGAT
GCAGCCAACGTACTACTGCAGCTCTCCCGGGGGGACTCTGGGACCCGGGACACTGTTCTC
AAGCTGCTACTGAATGGAGCCCGCCATCTGGGTTATACCCTTTGTAAACAAATAGGTACC
CTGCTGGCCGAGCTGCGGGAATACAACCTCGAGCAGCAGCGGCGAGCCCAATGTGAAACC
CTCTCTCCTGATGGCCTGCCTGAGGAGCAGCCACAGACCACCAAGCTGAAGGGCAAAATG
CAGAGCAGGTTTGACATGGCTGAGAATGTGGTAATTGTGGCATCTCAGAAGCGACCTTTG
GGTGGCCGGGAGCTCCAGCTGCCTTCTATGTCCATGTTGACATCCAAGACATCTACCCAG
AAGTTCTTCTTGAGGGTACTACAGGTCATCATCCAGCTCCGGGACGACACGCGCCGGGCT
AACAAGAAAGCCAAGCAGACAGGCAGGCTAGGTTCCTCCGGTTTAGGCTCAGCTAGCAGC
ATCCAGGCAGCTGTTCGGCAGCTGGAGGCTGAGGCTGATGCCATTATACAAATGGTACGT
GAGGGTCAAAGGGCGCGGAGACAGCAACAAGCAGCAACGTCGGAGTCTAGCCAGTCAGAG
GCGTCTGTCCGGAGGGAGGAATCACCCATGGATGTGGACCAGCCATCTCCCAGTGCTCAA
GATACTCAATCCATTGCCTCCGATGGAACCCCACAGGGGGAGAAGGAAAAGGAAGAAAGA
CCACCTGAGTTACCCCTGCTCAGCGAGCAGCTGAGTTTGGACGAGCTGTGGGACATGCTT
GGGGAGTGTCTAAAGGAACTAGAGGAATCCCATGACCAGCATGCGGTGCTAGTGCTACAG
CCTGCTGTCGAGGCCTTCTTTCTGGTCCATGCCACAGAGCGGGAGAGCAAGCCTCCTGTC
CGAGACACCCGTGAGAGCCAGCTGGCACACATCAAGGACGAGCCTCCTCCACTCTCCCCT
GCCCCCTTAACCCCAGCCACGCCTTCCTCCCTTGACCCATTCTTCTCCCGGGAGCCCTCA
TCTATGCACATCTCCTCAAGCCTGCCCCCTGACACACAGAAGTTCCTTCGCTTTGCAGAG
ACTCACCGCACTGTGTTAAACCAGATCCTACGGCAGTCCACGACCCACCTTGCTGATGGG
CCTTTTGCTGTCCTGGTAGACTACATTCGTGTCCTCGACTTTGATGTCAAGCGCAAATAT
TTCCGCCAAGAGCTGGAGCGTTTAGATGAGGGGCTCCGGAAAGAAGACATGGCTGTGCAT
GTCCGTCGTGACCATGTGTTTGAAGACTCCTATCGTGAGCTGCATCGCAAATCCCCCGAA
GAAATGAAGAATCGATTGTATATAGTATTTGAAGGAGAAGAAGGGCAGGATGCTGGTGGG
CTCCTGCGGGAGTGGTATATGATCATCTCTCGAGAGATGTTTAACCCTATGTATGCCTTG
TTCCGTACCTCACCTGGTGATCGAGTCACCTACACCATCAATCCATCTTCCCACTGCAAC
CCCAACCACCTCAGCTACTTCAAGTTTGTCGGACGCATTGTGGCCAAAGCTGTATATGAC
AACCGTCTTCTGGAGTGCTACTTTACTCGATCCTTTTACAAACACATCTTGGGCAAGTCA
GTCAGATATACAGATATGGAGAGTGAAGATTACCACTTCTACCAAGGTCTGGTTTATCTG
CTGGAAAATGATGTCTCCACACTAGGCTATGACCTCACCTTCAGCACTGAGGTCCAAGAG
TTTGGAGTTTGTGAAGTTCGTGACCTCAAACCCAATGGGGCCAACATCTTGGTAACAGAG
GAGAATAAGAAGGAGTATGTACACCTGGTATGCCAGATGAGAATGACAGGAGCCATCCGC
AAGCAGTTGGCGGCTTTCTTAGAAGGCTTCTATGAGATCATTCCAAAGCGCCTCATTTCC
ATCTTCACTGAGCAGGAGTTAGAGCTGCTTATATCAGGACTGCCCACCATTGACATCGAT
GATCTGAAATCCAACACTGAATACCACAAGTACCAGTCCAACTCTATTCAGATCCAGTGG
TTCTGGAGAGCATTGCGTTCTTTCGATCAAGCTGACCGTGCCAAGTTCCTCCAGTTTGTC
ACGGGTACTTCCAAGGTACCCCTGCAAGGCTTTGCTGCCCTCGAAGGCATGAATGGCATT
CAGAAGTTTCAGATCCATCGAGATGACAGGTCCACAGATCGCCTGCCTTCAGCTCACACA
TGTTTTAATCAGCTGGATCTGCCTGCCTATGAGAGCTTTGAGAAGCTCCGCCACATGCTA
CTGTTGGCTATCCAGGAGTGCTCTGAAGGCTTTGGGCTGGCCTAA
Protein Properties
Number of Residues 4374
Molecular Weight 481885.7
Theoretical pI 4.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase HUWE1
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSL
KHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREV
LGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLG
SAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNH
AAEEASSEDEEEEEVQAMQSFNSTQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESI
LSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKV
LQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAH
AYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSL
PSGCEFGQADMQKLVPKDEKAGTTQGGKRSDGEQDGAAGSMDASTQGLLEGIGLDGDTLA
PMETDEPTASDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVSEGLEHSDLPDGTGEFLD
AWLMLVEKMVNPTTVLESPHSLPAKLPGGVQNFPQFSALRFLVVTQKAAFTCIKNLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRREPQVNQQ
QLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIA
MSLGQDIPMDQRAESPEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFT
DTMLPGCFHLLDELPDTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAAL
PLTTSDTKTVSEWISQMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKL
LEVVQPCLQAAKEQKEVQTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNSNNWRWF
DDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVML
TLLRVPRLNKNSKNSNGQELEKTLEESKEMDIKRKENKGNDTPLALESTNTEKETSLEET
KIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKS
TRMILNLTQSSGFNGFTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVVSG
SLGSREINYILRVLGPAACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKGPN
AVQLVKTTPLKPSPLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPKPGVMTQEVGQLL
QDMGDDVYQQYRSLTRQSSDFDTQSGFSINSQVFAADGASTETSASGTSQGEASTPEESR
DGKKDKEGDRASEEGKQKGKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQSE
LIKEDCSVLAFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAAL
GRALAMAESTEKHARLQAVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLKKG
LVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASSKNKSEQDAQ
GASQDSSSNQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVIAGQPEVLSSQ
EMQVENELEDLIDELLERDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQANR
EDSMNILDPEDEEEHTQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDDDD
DGSEMELDEDYPDMNASPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLMV
RHADHSSLTLGSGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRL
LGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGT
LSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLEFLRDEELEERREKRRKQLAEE
ETKITDKGKEDKENRDQSAQCTASKSNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESKE
TLGTLQSSQQQPTLPTPPALGEVPQELQSPAGEGGSSTQLLMPVEPEELGPTRPSGEAET
TQMELSPAPTITSLSPERAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTSAAGSS
EQPRAGSSTPGDAPPAVAEVQGRSDGSGESAQPPEDSSPPASSESSSTRDSAVAISGADS
RGILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPS
TNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPMDPVT
FIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSA
LSAILRSPAFTSRLSGNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLLRLRGRLL
LDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSESELCI
ETPKLTTSEEKGKKSSKSCGSSSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCRTNI
FQIQRSGGRKHTEKHASGGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKETN
CESDRERGNKACSPCSSQSSSSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSAGGEGE
TSPYSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPENKVSEAQANSGSGA
SSTTTATSTTSTTTTTAASTTPTPPTAPTPVTSAPALVAATAISTIVVAASTTVTTPTTA
TTTVSISPTTKGSKSPAKVSDGGSSSTDFKMVSSGLTENQLQLSVEVLTSHSCSEEGLED
AANVLLQLSRGDSGTRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRAQCET
LSPDGLPEEQPQTTKLKGKMQSRFDMAENVVIVASQKRPLGGRELQLPSMSMLTSKTSTQ
KFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSASSIQAAVRQLEAEADAIIQMVR
EGQRARRQQQAATSESSQSEASVRREESPMDVDQPSPSAQDTQSIASDGTPQGEKEKEER
PPELPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPV
RDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSSLPPDTQKFLRFAE
THRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVH
VRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYAL
FRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS
VRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTE
ENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDID
DLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGI
QKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
GenBank ID Protein 61676188
UniProtKB/Swiss-Prot ID Q7Z6Z7
UniProtKB/Swiss-Prot Entry Name HUWE1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031407.4
GeneCard ID HUWE1
GenAtlas ID HUWE1
HGNC ID HGNC:30892
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  11. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  12. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  13. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  14. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  15. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  16. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  17. Froyen G, Corbett M, Vandewalle J, Jarvela I, Lawrence O, Meldrum C, Bauters M, Govaerts K, Vandeleur L, Van Esch H, Chelly J, Sanlaville D, van Bokhoven H, Ropers HH, Laumonnier F, Ranieri E, Schwartz CE, Abidi F, Tarpey PS, Futreal PA, Whibley A, Raymond FL, Stratton MR, Fryns JP, Scott R, Peippo M, Sipponen M, Partington M, Mowat D, Field M, Hackett A, Marynen P, Turner G, Gecz J: Submicroscopic duplications of the hydroxysteroid dehydrogenase HSD17B10 and the E3 ubiquitin ligase HUWE1 are associated with mental retardation. Am J Hum Genet. 2008 Feb;82(2):432-43. doi: 10.1016/j.ajhg.2007.11.002. Epub 2008 Jan 24. [PubMed:18252223 ]
  18. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  19. Nagase T, Kikuno R, Nakayama M, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Aug 31;7(4):273-81. [PubMed:10997877 ]
  20. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  21. Zhong Q, Gao W, Du F, Wang X: Mule/ARF-BP1, a BH3-only E3 ubiquitin ligase, catalyzes the polyubiquitination of Mcl-1 and regulates apoptosis. Cell. 2005 Jul 1;121(7):1085-95. [PubMed:15989957 ]
  22. Chen D, Kon N, Li M, Zhang W, Qin J, Gu W: ARF-BP1/Mule is a critical mediator of the ARF tumor suppressor. Cell. 2005 Jul 1;121(7):1071-83. [PubMed:15989956 ]
  23. Liu Z, Oughtred R, Wing SS: Characterization of E3Histone, a novel testis ubiquitin protein ligase which ubiquitinates histones. Mol Cell Biol. 2005 Apr;25(7):2819-31. [PubMed:15767685 ]
  24. Yoon SY, Lee Y, Kim JH, Chung AS, Joo JH, Kim CN, Kim NS, Choe IS, Kim JW: Over-expression of human UREB1 in colorectal cancer: HECT domain of human UREB1 inhibits the activity of tumor suppressor p53 protein. Biochem Biophys Res Commun. 2005 Jan 7;326(1):7-17. [PubMed:15567145 ]
  25. Hall JR, Kow E, Nevis KR, Lu CK, Luce KS, Zhong Q, Cook JG: Cdc6 stability is regulated by the Huwe1 ubiquitin ligase after DNA damage. Mol Biol Cell. 2007 Sep;18(9):3340-50. Epub 2007 Jun 13. [PubMed:17567951 ]
  26. Zhao X, Heng JI, Guardavaccaro D, Jiang R, Pagano M, Guillemot F, Iavarone A, Lasorella A: The HECT-domain ubiquitin ligase Huwe1 controls neural differentiation and proliferation by destabilizing the N-Myc oncoprotein. Nat Cell Biol. 2008 Jun;10(6):643-53. doi: 10.1038/ncb1727. Epub 2008 May 18. [PubMed:18488021 ]