You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09274
Secondary Accession Numbers
  • 15102
Name E3 ubiquitin-protein ligase UBR2
Synonyms
  1. N-recognin-2
  2. Ubiquitin-protein ligase E3-alpha-2
  3. Ubiquitin-protein ligase E3-alpha-II
Gene Name UBR2
Protein Type Enzyme
Biological Properties
General Function Involved in protein catabolic process
Specific Function E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
small conjugating protein ligase activity
transition metal ion binding
zinc ion binding
ligase activity
protein binding
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
ubiquitin-protein ligase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
protein catabolic process
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.1
SNPs UBR2
Gene Sequence
>5268 bp
ATGGCGTCGGAGCTAGAGCCAGAGGTGCAGGCCATCGACCGGAGCTTGCTGGAATGTTCG
GCCGAGGAGATTGCGGGGAAATGGCTGCAAGCAACTGACCTCACTAGAGAAGTGTACCAG
CATTTAGCCCACTATGTACCCAAAATCTACTGCAGGGGTCCCAACCCTTTTCCACAGAAA
GAAGACATGCTGGCACAGCATGTTTTGTTGGGACCAATGGAATGGTACCTTTGTGGTGAA
GATCCTGCATTTGGATTTCCAAAACTTGAGCAAGCAAACAAACCTTCTCATCTTTGTGGT
CGTGTTTTTAAAGTAGGAGAGCCTACATATTCTTGCAGAGACTGTGCAGTTGATCCAACT
TGTGTTTTGTGCATGGAGTGCTTTTTGGGAAGTATTCACAGAGATCATCGATATAGGATG
ACAACATCAGGAGGTGGAGGTTTCTGTGACTGTGGTGATACTGAAGCCTGGAAAGAGGGT
CCTTACTGTCAAAAACATGAACTTAACACCTCTGAAATTGAGGAAGAAGAGGATCCTCTT
GTTCATTTATCAGAAGATGTGATAGCAAGAACTTATAACATTTTTGCTATTACGTTTCGG
TATGCAGTAGAAATATTAACCTGGGAAAAAGAAAGTGAATTGCCAGCAGATTTAGAGATG
GTAGAGAAGAGTGACACCTACTATTGCATGCTGTTTAATGATGAGGTTCACACCTATGAA
CAAGTTATTTATACTCTTCAGAAAGCTGTTAACTGTACACAAAAAGAAGCTATTGGTTTT
GCAACTACAGTAGATCGAGATGGGCGTAGGTCTGTTCGATATGGAGATTTTCAGTATTGT
GAGCAAGCAAAATCAGTAATTGTGAGAAATACCAGTAGACAGACAAAGCCACTCAAAGTT
CAAGTTATGCATTCGTCTATTGTCGCACATCAGAATTTTGGTTTGAAACTTTTGTCTTGG
CTGGGAAGTATTATTGGATATTCAGATGGCCTTCGCCGGATTTTATGTCAAGTTGGTTTA
CAAGAAGGGCCAGATGGTGAAAACTCTTCTCTAGTGGACAGACTGATGCTTAGTGATTCC
AAATTATGGAAAGGTGCTAGGAGTGTATATCATCAGTTGTTCATGAGCAGTCTGCTTATG
GATTTGAAATACAAGAAACTATTTGCTGTTCGATTTGCAAAAAATTACCAGCAGTTGCAG
AGAGATTTTATGGAGGATGATCACGAGCGAGCAGTGTCGGTGACTGCTCTATCTGTCCAG
TTCTTCACCGCACCTACTCTGGCTCGAATGCTCATCACAGAAGAAAACTTAATGAGCATT
ATCATTAAGACTTTTATGGATCATTTGAGACATCGAGATGCCCAGGGCAGATTTCAGTTT
GAACGATACACTGCTTTACAAGCCTTCAAATTTAGGAGAGTACAGAGCCTTATTTTAGAT
CTCAAGTATGTGTTAATTAGCAAACCAACTGAATGGTCAGATGAGCTGAGGCAGAAGTTC
CTAGAAGGGTTTGATGCCTTTTTGGAATTACTAAAATGTATGCAGGGAATGGATCCAATT
ACACGTCAAGTAGGACAACATATTGAAATGGAACCAGAGTGGGAAGCAGCCTTCACACTA
CAAATGAAATTAACACATGTCATTTCAATGATGCAGGACTGGTGTGCTTCAGATGAAAAA
GTGTTAATCGAAGCTTACAAGAAATGTCTCGCTGTACTGATGCAGTGTCATGGTGGTTAT
ACTGATGGTGAACAGCCAATCACACTAAGCATTTGTGGACATTCAGTGGAAACTATCAGA
TACTGTGTTTCCCAAGAAAAAGTTAGCATTCACCTCCCAGTTTCTCGCTTACTTGCAGGT
TTACATGTATTATTAAGCAAAAGTGAAGTGGCATATAAATTTCCAGAGCTCCTACCTCTA
AGTGAACTTAGCCCACCCATGTTGATAGAACACCCTCTTAGATGTCTTGTTCTGTGTGCC
CAAGTACATGCCGGAATGTGGAGAAGAAATGGGTTCTCTCTAGTAAACCAGATTTATTAC
TACCATAATGTGAAATGCAGACGTGAGATGTTTGACAAGGATGTAGTAATGCTTCAGACA
GGTGTCTCCATGATGGATCCAAATCATTTCCTGATGATCATGCTCAGCCGCTTTGAACTT
TATCAGATTTTCAGTACTCCAGACTATGGAAAAAGATTTAGTTCTGAGATTACCCATAAG
GATGTTGTTCAGCAGAACAATACTCTAATAGAAGAAATGCTATACCTCATTATAATGCTT
GTTGGAGAGAGATTTAGTCCTGGAGTTGGACAGGTAAATGCTACAGATGAAATCAAGCGA
GAGATTATCCATCAGTTGAGTATCAAGCCTATGGCTCATAGTGAATTGGTAAAGTCTTTA
CCTGAAGATGAGAACAAGGAGACTGGCATGGAGAGTGTAATCGAAGCAGTTGCCCATTTC
AAGAAACCTGGATTAACAGGACGAGGCATGTATGAACTGAAACCAGAATGTGCCAAAGAG
TTCAACTTGTATTTCTATCACTTTTCAAGGGCAGAACAGTCCAAGGCAGAAGAAGCGCAA
CGGAAATTGAAAAGACAAAATAGAGAAGATACAGCACTCCCACCTCCGGTGTTGCCTCCA
TTCTGCCCTCTGTTTGCAAGCCTGGTTAACATTTTGCAGTCAGATGTCATGTTGTGCATC
ATGGGAACAATTCTGCAATGGGCTGTGGAACATAATGGATATGCCTGGTCAGAGTCCATG
CTGCAAAGGGTGTTACATTTAATTGGCATGGCACTACAAGAAGAAAAACAACATTTAGAG
AATGTCACGGAAGAGCATGTAGTAACATTTACCTTCACTCAGAAGATATCAAAACCTGGT
GAAGCGCCAAAAAATTCTCCTAGCATACTAGCTATGCTGGAAACACTACAAAATGCTCCC
TACCTAGAAGTCCACAAAGACATGATTCGGTGGATATTGAAGACTTTTAATGCTGTTAAA
AAGATGAGGGAGAGTTCACCTACCAGTCCCGTGGCAGAGACAGAAGGAACCATAATGGAA
GAGAGTTCAAGGGACAAAGACAAAGCTGAGAGGAAGAGAAAAGCAGAGATTGCCAGACTG
CGCAGAGAAAAGATCATGGCTCAGATGTCTGAAATGCAGCGGCATTTTATTGATGAAAAC
AAAGAACTCTTTCAGCAGACATTAGAACTGGATGCCTCAACCTCTGCTGTTCTTGATCAT
AGCCCTGTGGCTTCAGATATGACACTTACAGCACTGGGCCCCGCACAAACTCAGGTTCCT
GAACAAAGACAATTCGTTACATGTATATTGTGTCAAGAGGAGCAAGAAGTTAAAGTGGAA
AGCAGGGCAATGGTCTTGGCAGCATTTGTTCAGAGATCAACTGTATTATCAAAAAACAGA
AGTAAATTTATTCAAGATCCAGAAAAATATGATCCATTATTCATGCACCCTGATCTGTCT
TGTGGAACACACACTAGTAGCTGTGGGCACATTATGCATGCCCATTGTTGGCAAAGGTAT
TTTGATTCCGTTCAAGCTAAAGAACAGCGAAGGCAACAGAGATTACGCTTACATACGAGC
TATGATGTAGAAAACGGAGAATTCCTTTGCCCCCTTTGTGAATGCTTGAGTAATACTGTT
ATTCCTCTGCTGCTTCCTCCAAGAAATATTTTTAACAACAGGTTAAATTTTTCAGACCAA
CCAAATCTGACTCAGTGGATTAGAACAATATCTCAGCAAATAAAAGCATTACAGTTTCTT
AGGAAAGAAGAAAGTACTCCTAATAATGCCTCTACAAAGAATTCAGAAAATGTGGATGAA
TTACAGCTCCCTGAAGGGTTCAGGCCTGATTTTCGTCCTAAGATCCCTTATTCTGAGAGC
ATAAAAGAAATGCTAACGACATTTGGAACTGCTACCTACAAGGTGGGACTAAAGGTTCAT
CCCAATGAAGAGGATCCTCGTGTTCCCATAATGTGTTGGGGTAGCTGCGCGTACACCATC
CAAAGCATAGAAAGAATTTTGAGTGATGAAGATAAACCATTGTTTGGTCCTTTACCTTGC
AGACTGGATGACTGTCTTAGGTCATTGACGAGATTTGCCGCAGCACACTGGACAGTGGCA
TCAGTTTCAGTGGTGCAAGGACATTTTTGTAAACTTTTTGCATCACTGGTGCCTAATGAC
AGCCATGAGGAACTTCCATGCATATTAGATATTGACATGTTTCATTTATTGGTGGGCTTG
GTGCTTGCATTTCCTGCGTTGCAGTGTCAGGATTTTTCAGGGATCAGCCTTGGCACTGGA
GACCTTCACATTTTCCATCTGGTTACTATGGCACACATCATACAGATCTTACTTACCTCA
TGTACAGAAGAGAATGGCATGGATCAAGAAAATCCCCCTTGTGAAGAAGAATCAGCAGTT
CTTGCTTTGTATAAAACACTTCACCAGTATACGGGAAGTGCCTTGAAAGAAATACCATCC
GGCTGGCATCTGTGGAGGAGTGTCAGAGCTGGAATCATGCCTTTCCTGAAGTGTTCTGCT
TTATTTTTTCATTACTTAAATGGAGTTCCTTCCCCACCCGACATTCAAGTTCCTGGAACA
AGCCATTTTGAACATTTATGTAGCTATCTTTCCCTACCAAACAACCTCATTTGCCTTTTT
CAAGAAAATAGTGAGATAATGAATTCACTGATTGAAAGTTGGTGCCGTAACAGTGAAGTT
AAAAGATATCTAGAAGGTGAAAGAGATGCTATAAGATATCCAAGAGAATCTAACAAATTA
ATAAACCTTCCAGAGGATTACAGCAGCCTCATTAATCAAGCATCCAATTTCTCGTGCCCG
AAATCAGGTGGTGATAAGAGCAGAGCCCCAACTCTGTGCCTTGTGTGCGGATCTCTGCTG
TGCTCCCAGAGTTACTGCTGCCAGACTGAACTGGAAGGGGAGGATGTAGGAGCCTGCACA
GCTCACACCTACTCCTGTGGCTCTGGAGTGGGCATCTTCCTGAGAGTACGGGAATGTCAG
GTGCTATTTTTAGCTGGCAAAACCAAAGGCTGTTTTTATTCTCCTCCTTACCTTGATGAC
TATGGGGAGACCGACCAGGGACTCAGACGGGGAAATCCTTTACATTTATGCAAAGAGCGA
TTCAAGAAGATTCAGAAGCTCTGGCACCAACACAGTGTCACAGAGGAAATTGGACATGCA
CAGGAAGCCAATCAGACACTGGTTGGCATTGACTGGCAACATTTATAA
Protein Properties
Number of Residues 1755
Molecular Weight 200536.4
Theoretical pI 6.19
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase UBR2
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQK
EDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPT
CVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPL
VHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYE
QVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKV
QVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDS
KLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYQQLQRDFMEDDHERAVSVTALSVQ
FFTAPTLARMLITEENLMSIIIKTFMDHLRHRDAQGRFQFERYTALQAFKFRRVQSLILD
LKYVLISKPTEWSDELRQKFLEGFDAFLELLKCMQGMDPITRQVGQHIEMEPEWEAAFTL
QMKLTHVISMMQDWCASDEKVLIEAYKKCLAVLMQCHGGYTDGEQPITLSICGHSVETIR
YCVSQEKVSIHLPVSRLLAGLHVLLSKSEVAYKFPELLPLSELSPPMLIEHPLRCLVLCA
QVHAGMWRRNGFSLVNQIYYYHNVKCRREMFDKDVVMLQTGVSMMDPNHFLMIMLSRFEL
YQIFSTPDYGKRFSSEITHKDVVQQNNTLIEEMLYLIIMLVGERFSPGVGQVNATDEIKR
EIIHQLSIKPMAHSELVKSLPEDENKETGMESVIEAVAHFKKPGLTGRGMYELKPECAKE
FNLYFYHFSRAEQSKAEEAQRKLKRQNREDTALPPPVLPPFCPLFASLVNILQSDVMLCI
MGTILQWAVEHNGYAWSESMLQRVLHLIGMALQEEKQHLENVTEEHVVTFTFTQKISKPG
EAPKNSPSILAMLETLQNAPYLEVHKDMIRWILKTFNAVKKMRESSPTSPVAETEGTIME
ESSRDKDKAERKRKAEIARLRREKIMAQMSEMQRHFIDENKELFQQTLELDASTSAVLDH
SPVASDMTLTALGPAQTQVPEQRQFVTCILCQEEQEVKVESRAMVLAAFVQRSTVLSKNR
SKFIQDPEKYDPLFMHPDLSCGTHTSSCGHIMHAHCWQRYFDSVQAKEQRRQQRLRLHTS
YDVENGEFLCPLCECLSNTVIPLLLPPRNIFNNRLNFSDQPNLTQWIRTISQQIKALQFL
RKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVH
PNEEDPRVPIMCWGSCAYTIQSIERILSDEDKPLFGPLPCRLDDCLRSLTRFAAAHWTVA
SVSVVQGHFCKLFASLVPNDSHEELPCILDIDMFHLLVGLVLAFPALQCQDFSGISLGTG
DLHIFHLVTMAHIIQILLTSCTEENGMDQENPPCEEESAVLALYKTLHQYTGSALKEIPS
GWHLWRSVRAGIMPFLKCSALFFHYLNGVPSPPDIQVPGTSHFEHLCSYLSLPNNLICLF
QENSEIMNSLIESWCRNSEVKRYLEGERDAIRYPRESNKLINLPEDYSSLINQASNFSCP
KSGGDKSRAPTLCLVCGSLLCSQSYCCQTELEGEDVGACTAHTYSCGSGVGIFLRVRECQ
VLFLAGKTKGCFYSPPYLDDYGETDQGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHA
QEANQTLVGIDWQHL
GenBank ID Protein 27597061
UniProtKB/Swiss-Prot ID Q8IWV8
UniProtKB/Swiss-Prot Entry Name UBR2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015255.2
GeneCard ID UBR2
GenAtlas ID UBR2
HGNC ID HGNC:21289
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  5. Kwak KS, Zhou X, Solomon V, Baracos VE, Davis J, Bannon AW, Boyle WJ, Lacey DL, Han HQ: Regulation of protein catabolism by muscle-specific and cytokine-inducible ubiquitin ligase E3alpha-II during cancer cachexia. Cancer Res. 2004 Nov 15;64(22):8193-8. [PubMed:15548684 ]
  6. Yin J, Kwon YT, Varshavsky A, Wang W: RECQL4, mutated in the Rothmund-Thomson and RAPADILINO syndromes, interacts with ubiquitin ligases UBR1 and UBR2 of the N-end rule pathway. Hum Mol Genet. 2004 Oct 15;13(20):2421-30. Epub 2004 Aug 18. [PubMed:15317757 ]
  7. Kume K, Iizumi Y, Shimada M, Ito Y, Kishi T, Yamaguchi Y, Handa H: Role of N-end rule ubiquitin ligases UBR1 and UBR2 in regulating the leucine-mTOR signaling pathway. Genes Cells. 2010 Apr 1;15(4):339-49. doi: 10.1111/j.1365-2443.2010.01385.x. Epub 2010 Mar 16. [PubMed:20298436 ]
  8. Zenker M, Mayerle J, Lerch MM, Tagariello A, Zerres K, Durie PR, Beier M, Hulskamp G, Guzman C, Rehder H, Beemer FA, Hamel B, Vanlieferinghen P, Gershoni-Baruch R, Vieira MW, Dumic M, Auslender R, Gil-da-Silva-Lopes VL, Steinlicht S, Rauh M, Shalev SA, Thiel C, Ekici AB, Winterpacht A, Kwon YT, Varshavsky A, Reis A: Deficiency of UBR1, a ubiquitin ligase of the N-end rule pathway, causes pancreatic dysfunction, malformations and mental retardation (Johanson-Blizzard syndrome). Nat Genet. 2005 Dec;37(12):1345-50. Epub 2005 Nov 20. [PubMed:16311597 ]