You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09310
Secondary Accession Numbers
  • 15142
Name Ubiquitin-conjugating enzyme E2 Z
Synonyms
  1. Uba6-specific E2 conjugating enzyme 1
  2. Ubiquitin carrier protein Z
  3. Ubiquitin-protein ligase Z
  4. Use1
Gene Name UBE2Z
Protein Type Enzyme
Biological Properties
General Function Involved in acid-amino acid ligase activity
Specific Function Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.
Pathways
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
apoptotic process
Cellular Component
cytoplasm
nucleus
Function
catalytic activity
small conjugating protein ligase activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Molecular Function
ubiquitin-protein ligase activity
ATP binding
Process
metabolic process
regulation of protein metabolic process
macromolecule metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
post-translational protein modification
macromolecule modification
protein modification process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 17
Locus 17q21.32
SNPs UBE2Z
Gene Sequence
>1065 bp
ATGGCGGAGAGTCCGACTGAGGAGGCGGCAACGGCGGGCGCCGGGGCGGCGGGCCCCGGG
GCGAGCAGCGTTGCTGGTGTTGTTGGCGTTAGCGGCAGCGGCGGCGGGTTCGGGCCGCCT
TTCCTGCCGGATGTGTGGGCGGCGGCGGCGGCAGCGGGCGGGGCCGGGGGCCCGGGGAGC
GGCCTGGCTCCGCTGCCCGGGCTCCCGCCCTCAGCCGCTGCCCACGGGGCCGCGCTGCTT
AGCCACTGGGACCCCACGCTCAGCTCCGACTGGGACGGCGAGCGCACCGCGCCGCAGTGT
CTACTCCGGATCAAGCGGGATATCATGTCCATTTATAAGGAGCCTCCTCCAGGAATGTTC
GTTGTACCTGATACTGTTGACATGACTAAGATTCATGCATTGATCACAGGCCCATTTGAC
ACTCCTTATGAAGGGGGTTTCTTCCTGTTCGTGTTTCGGTGTCCGCCCGACTATCCCATC
CACCCACCTCGGGTCAAACTGATGACAACGGGCAATAACACAGTGAGGTTTAACCCCAAC
TTCTACCGCAATGGGAAAGTCTGCTTGAGTATTCTAGGTACATGGACTGGACCTGCCTGG
AGCCCAGCCCAGAGCATCTCCTCAGTGCTCATCTCTATCCAGTCCCTGATGACTGAGAAC
CCCTATCACAATGAGCCCGGCTTTGAACAGGAGAGACATCCAGGAGACAGCAAAAACTAT
AATGAATGTATCCGGCACGAGACCATCAGAGTTGCAGTCTGTGACATGATGGAAGGAAAG
TGTCCCTGTCCTGAACCCCTACGAGGGGTGATGGAGAAGTCCTTTCTGGAGTATTACGAC
TTCTACGAGGTGGCCTGCAAAGATCGCCTGCACCTTCAAGGCCAAACTATGCAGGACCCT
TTTGGAGAGAAGCGGGGCCACTTTGACTACCAGTCCCTCTTGATGCGCCTGGGACTGATA
CGTCAGAAAGTGCTGGAGAGGCTCCATAATGAGAATGCAGAAATGGACTCTGATAGCAGT
TCATCTGGGACAGAGACAGACCTTCATGGGAGCCTGAGGGTTTAG
Protein Properties
Number of Residues 354
Molecular Weight 38209.875
Theoretical pI 5.617
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ubiquitin-conjugating enzyme E2 Z
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
GenBank ID Protein 150417999
UniProtKB/Swiss-Prot ID Q9H832
UniProtKB/Swiss-Prot Entry Name UBE2Z_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_023079.4
GeneCard ID UBE2Z
GenAtlas ID UBE2Z
HGNC ID HGNC:25847
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Jin J, Li X, Gygi SP, Harper JW: Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging. Nature. 2007 Jun 28;447(7148):1135-8. [PubMed:17597759 ]
  6. Gu X, Zhao F, Zheng M, Fei X, Chen X, Huang S, Xie Y, Mao Y: Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z). Mol Biol Rep. 2007 Sep;34(3):183-8. Epub 2006 Dec 12. [PubMed:17160626 ]
  7. Park KM, Kang E, Jeon YJ, Kim N, Kim NS, Yoo HS, Yeom YI, Kim SJ: Identification of novel regulators of apoptosis using a high-throughput cell-based screen. Mol Cells. 2007 Apr 30;23(2):170-4. [PubMed:17464193 ]