Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09311
Secondary Accession Numbers
  • 15143
Name Ubiquitin-like modifier-activating enzyme 7
Synonyms
  1. D8
  2. Ubiquitin-activating enzyme 7
  3. Ubiquitin-activating enzyme E1 homolog
Gene Name UBA7
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Activates ubiquitin by first adenylating with ATP its C- terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin- E1 thioester and free AMP
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
small protein activating enzyme activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21
SNPs UBA7
Gene Sequence
>3039 bp
ATGGATGCCCTGGACGCTTCGAAGCTACTGGATGAGGAGCTGTATTCAAGACAGCTGTAT
GTGCTGGGCTCACCTGCCATGCAGAGGATTCAGGGAGCCAGGGTCCTGGTGTCAGGCCTG
CAGGGCCTGGGGGCCGAGGTGGCCAAGAACTTGGTTCTGATGGGTGTGGGCAGCCTCACT
CTGCATGATCCCCACCCCACCTGCTGGTCCGACCTGGCTGCCCAGTTTCTCCTCTCAGAG
CAGGACTTGGAAAGGAGCAGAGCCGAGGCCTCTCAAGAGCTCTTGGCTCAGCTCAACAGA
GCTGTCCAGGTCGTCGTGCACACGGGTGACATCACTGAGGACCTGCTGTTGGACTTCCAG
GTGGTGGTGCTGACTGCTGCAAAGCTGGAGGAGCAGCTGAAGGTGGGCACCTTGTGTCAT
AAGCATGGAGTTTGCTTTCTGGCGGCTGACACCCGGGGCCTCGTGGGGCAGTTGTTCTGT
GACTTTGGTGAGGACTTCACTGTGCAGGACCCCACAGAGGCAGAACCCCTGACAGCTGCC
ATCCAGCACATCTCCCAGGGCTCCCCTGGCATTCTCACTCTGAGGAAAGGGGCCAATACC
CACTACTTCCGTGATGGAGACTTGGTGACTTTCTCGGGAATTGAGGGAATGGTTGAGCTC
AACGACTGTGATCCCCGGTCTATCCACGTGCGGGAGGATGGGTCCCTGGAGATTGGAGAC
ACAACAACTTTCTCTCGGTACTTGCGTGGTGGGGCTATCACTGAAGTCAAGAGACCCAAG
ACTGTGAGACATAAGTCCCTGGACACAGCCCTGCTCCAGCCCCATGTGGTGGCCCAGAGC
TCCCAGGAAGTTCACCATGCCCACTGCCTGCATCAGGCCTTCTGTGCACTGCACAAGTTC
CAGCACCTCCATGGCCGGCCACCCCAGCCCTGGGATCCTGTTGATGCAGAGACTGTGGTG
GGCCTGGCCCGGGACCTGGAACCACTGAAGCGGACAGAGGAAGAGCCACTGGAAGAGCCA
CTGGATGAGGCCCTAGTGCGGACAGTCGCCCTAAGCAGTGCAGGTGTCTTGAGCCCTATG
GTGGCCATGCTGGGTGCAGTAGCTGCCCAGGAAGTGCTGAAGGCAATCTCCAGGAAGTTC
ATGCCTCTGGACCAGTGGCTTTACTTTGATGCCCTCGATTGTCTTCCGGAAGATGGGGAG
CTCCTTCCCAGTCCTGAGGACTGTGCCCTGAGAGGCAGCCGCTATGATGGGCAAATTGCA
GTGTTTGGGGCTGGTTTTCAGGAGAAACTGAGACGCCAGCACTACCTCCTGGTGGGCGCT
GGTGCCATTGGTTGTGAGCTGCTCAAAGTCTTTGCCCTAGTGGGACTGGGGGCCGGGAAC
AGCGGGGGCTTGACTGTTGTTGACATGGACCACATAGAGCGCTCCAATCTCAGCCGTCAG
TTCCTCTTCAGGTCCCAGGACGTTGGTAGACCCAAGGCAGAGGTGGCTGCAGCAGCTGCC
CGGGGCCTGAACCCAGACTTACAGGTGATCCCGCTCACCTACCCACTGGATCCCACCACA
GAGCACATCTATGGGGATAACTTTTTCTCCCGTGTGGATGGTGTGGCTGCTGCCCTGGAC
AGTTTCCAGGCCCGGCGCTATGTGGCTGCTCGTTGCACCCACTATCTGAAGCCACTGCTG
GAGGCAGGCACATCGGGCACCTGGGGCAGTGCTACAGTATTCATGCCACATGTGACTGAG
GCCTACAGAGCCCCTGCCTCAGCTGCAGCTTCTGAGGATGCCCCCTACCCTGTCTGTACC
GTGCGGTACTTCCCTAGCACAGCCGAGCACACCCTGCAGTGGGCCCGGCATGAGTTTGAA
GAACTCTTCCGACTGTCTGCAGAGACCATCAACCACCACCAACAGGCACACACTTCCCTG
GCAGACATGGATGAGCCACAGACACTCACCTTACTGAAGCCAGTGCTTGGGGTCCTGAGA
GTGCGTCCACAGAACTGGCAAGACTGTGTGGCGTGGGCTCTTGGCCACTGGAAACTCTGC
TTTCATTATGGCATCAAACAGCTGCTGAGGCACTTCCCACCTAATAAAGTGCTTGAGGAT
GGAACTCCCTTCTGGTCAGGTCCCAAACAGTGTCCCCAGCCCTTGGAGTTTGACACCAAC
CAAGACACACACCTCCTCTACGTACTGGCAGCTGCCAACCTGTATGCCCAGATGCATGGG
CTGCCTGGCTCACAGGACTGGACTGCACTCAGGGAGCTGCTGAAGCTGCTGCCACAGCCT
GACCCCCAACAGATGGCCCCCATCTTTGCTAGTAATCTAGAGCTGGCTTCGGCTTCTGCT
GAGTTTGGCCCTGAGCAGCAGAAGGAACTGAACAAAGCCCTGGAAGTCTGGAGTGTGGGC
CCTCCCCTGAAGCCTCTGATGTTTGAGAAGGATGATGACAGCAACTTCCATGTGGACTTT
GTGGTAGCGGCAGCTAGCCTGAGATGTCAGAACTACGGGATTCCACCGGTCAACCGTGCC
CAGAGCAAGCGAATTGTGGGCCAGATTATCCCAGCCATTGCCACCACTACAGCAGCTGTG
GCAGGCCTGTTGGGCCTGGAGCTGTATAAGGTGGTGAGTGGGCCACGGCCTCGTAGTGCC
TTTCGCCACAGCTACCTACATCTGGCTGAAAACTACCTCATCCGCTATATGCCTTTTGCC
CCAGCCATCCAGACGTTCCATCACCTGAAGTGGACCTCTTGGGACCGTCTGAAGGTACCA
GCTGGGCAGCCTGAGAGGACCCTGGAGTCGCTGCTGGCTCATCTTCAGGAGCAGCACGGG
TTGAGGGTGAGGATCCTGCTGCACGGCTCAGCCCTGCTCTATGCGGCCGGATGGTCACCT
GAAAAGCAGGCCCAGCACCTGCCCCTCAGGGTGACAGAACTGGTTCAGCAGCTGACAGGC
CAGGCACCTGCTCCTGGGCAGCGGGTGTTGGTGCTAGAGCTGAGCTGTGAGGGTGACGAC
GAGGACACTGCCTTCCCACCTCTGCACTATGAGCTGTGA
Protein Properties
Number of Residues 1012
Molecular Weight 111693.3
Theoretical pI 5.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin-like modifier-activating enzyme 7
MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLT
LHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQ
VVVLTAAKLEEQLKVGTLCHKHGVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAA
IQHISQGSPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEIGD
TTTFSRYLRGGAITEVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKF
QHLHGRPPQPWDPVDAETVVGLARDLEPLKRTEEEPLEEPLDEALVRTVALSSAGVLSPM
VAMLGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGELLPSPEDCALRGSRYDGQIA
VFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGAGNSGGLTVVDMDHIERSNLSRQ
FLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAALD
SFQARRYVAARCTHYLKPLLEAGTSGTWGSATVFMPHVTEAYRAPASAAASEDAPYPVCT
VRYFPSTAEHTLQWARHEFEELFRLSAETINHHQQAHTSLADMDEPQTLTLLKPVLGVLR
VRPQNWQDCVAWALGHWKLCFHYGIKQLLRHFPPNKVLEDGTPFWSGPKQCPQPLEFDTN
QDTHLLYVLAAANLYAQMHGLPGSQDWTALRELLKLLPQPDPQQMAPIFASNLELASASA
EFGPEQQKELNKALEVWSVGPPLKPLMFEKDDDSNFHVDFVVAAASLRCQNYGIPPVNRA
QSKRIVGQIIPAIATTTAAVAGLLGLELYKVVSGPRPRSAFRHSYLHLAENYLIRYMPFA
PAIQTFHHLKWTSWDRLKVPAGQPERTLESLLAHLQEQHGLRVRILLHGSALLYAAGWSP
EKQAQHLPLRVTELVQQLTGQAPAPGQRVLVLELSCEGDDEDTAFPPLHYEL
GenBank ID Protein 38045948
UniProtKB/Swiss-Prot ID P41226
UniProtKB/Swiss-Prot Entry Name UBA7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003335.2
GeneCard ID UBA7
GenAtlas ID UBA7
HGNC ID HGNC:12471
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Kok K, Hofstra R, Pilz A, van den Berg A, Terpstra P, Buys CH, Carritt B: A gene in the chromosomal region 3p21 with greatly reduced expression in lung cancer is similar to the gene for ubiquitin-activating enzyme. Proc Natl Acad Sci U S A. 1993 Jul 1;90(13):6071-5. [PubMed:8327486 ]
  4. Kok K, Van den Berg A, Veldhuis PM, Franke M, Terpstra P, Buys CH: The genomic structure of the human UBE1L gene. Gene Expr. 1995;4(3):163-75. [PubMed:7734949 ]
  5. Yuan W, Krug RM: Influenza B virus NS1 protein inhibits conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein. EMBO J. 2001 Feb 1;20(3):362-71. [PubMed:11157743 ]
  6. Lenschow DJ, Giannakopoulos NV, Gunn LJ, Johnston C, O'Guin AK, Schmidt RE, Levine B, Virgin HW 4th: Identification of interferon-stimulated gene 15 as an antiviral molecule during Sindbis virus infection in vivo. J Virol. 2005 Nov;79(22):13974-83. [PubMed:16254333 ]