You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09346
Secondary Accession Numbers
  • 15194
Name Zinc ribbon domain containing 1
Synonyms
  1. SubName: Zinc ribbon domain containing, 1
  2. SubName: Zinc ribbon domain containing, 1, isoform CRA_a
Gene Name ZNRD1
Protein Type Enzyme
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
transcription regulator activity
nucleic acid binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs ZNRD1
Gene Sequence
>381 bp
ATGTCTGTCATGGACCTCGCCAATACTTGCTCCAGCTTTCAGTCGGACCTGGATTTCTGT
TCAGATTGCGGCTCGGTCCTGCCTCTGCCCGGGGCTCAGGATACGGTCACCTGTATTCGC
TGTGGCTTCAACATCAACGTTCGGGACTTTGAGGGGAAGGTTGTGAAGACTTCGGTTGTG
TTCCACCAACTGGGGACAGCCATGCCTATGTCGGTGGAGGAAGGGCCTGAGTGCCAGGGA
CCTGTGGTTGACAGGCGCTGCCCTCGATGTGGTCATGAAGGAATGGCATACCACACCAGA
CAGATGCGTTCAGCCGATGAAGGGCAAACTGTCTTCTACACCTGTACCAACTGCAAGTTC
CAGGAGAAGGAAGACTCTTGA
Protein Properties
Number of Residues 126
Molecular Weight 13903.6
Theoretical pI 4.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc ribbon domain containing 1
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF
QEKEDS
GenBank ID Protein 86197925
UniProtKB/Swiss-Prot ID Q2L6J2
UniProtKB/Swiss-Prot Entry Name Q2L6J2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB202082
GeneCard ID ZNRD1
GenAtlas ID ZNRD1
HGNC ID HGNC:13182
References
General References
  1. Shiina T, Ota M, Shimizu S, Katsuyama Y, Hashimoto N, Takasu M, Anzai T, Kulski JK, Kikkawa E, Naruse T, Kimura N, Yanagiya K, Watanabe A, Hosomichi K, Kohara S, Iwamoto C, Umehara Y, Meyer A, Wanner V, Sano K, Macquin C, Ikeo K, Tokunaga K, Gojobori T, Inoko H, Bahram S: Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity. Genetics. 2006 Jul;173(3):1555-70. Epub 2006 May 15. [PubMed:16702430 ]