Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09367
Secondary Accession Numbers
  • 15231
Name Peptidoglycan recognition protein 4
Synonyms
  1. Peptidoglycan recognition protein I-beta
  2. Peptidoglycan recognition protein intermediate beta
  3. PGLYRPIbeta
  4. PGRP-I-beta
Gene Name PGLYRP4
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.
Pathways Not Available
Reactions
N-Acetylmuramoyl-Ala + Water → N-Acetylmuramate + L-Alanine details
GO Classification
Biological Process
detection of bacterium
growth of symbiont in host
negative regulation of interferon-gamma production
negative regulation of natural killer cell differentiation involved in immune response
peptidoglycan catabolic process
defense response to Gram-positive bacterium
innate immune response
Cellular Component
intracellular
extracellular region
membrane
Function
n-acetylmuramoyl-l-alanine amidase activity
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
protein binding
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Molecular Function
N-acetylmuramoyl-L-alanine amidase activity
peptidoglycan binding
peptidoglycan receptor activity
zinc ion binding
Process
cellular carbohydrate metabolism
peptidoglycan metabolism
peptidoglycan catabolism
physiological process
metabolism
macromolecule metabolism
carbohydrate metabolism
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Q5SY64
Gene Sequence
>1122 bp
ATGCTGCCGTGGCTTCTTGTCTTCTCTGCTCTGGGTATCCAGGCCTGGGGTGATTCCTCC
TGGAACAAAACACAAGCTAAACAGGTATCAGAGGGGCTCCAGTACCTATTTGAGAACATC
TCCCAGCTCACTGAAAAAGGCCTTCCCACAGATGTCTCCACCACGGTCTCTCGCAAGGCA
TGGGGGGCAGAAGCTGTTGGCTGCAGTATTCAGCTGACCACGCCAGTGAATGTCCTTGTT
ATACACCATGTCCCTGGACTGGAGTGTCACGACCAGACAGTCTGCAGCCAGAGACTGCGG
GAACTGCAGGCCCATCATGTCCACAACAACAGTGGGTGTGATGTGGCCTACAACTTCCTG
GTTGGGGATGATGGCAGGGTGTATGAAGGTGTTGGCTGGAATATCCAAGGAGTGCACACC
CAAGGCTACAACAACATCTCCCTGGGCTTTGCCTTCTTTGGCACTAAGAAAGGCCACAGT
CCCAGCCCTGCTGCCCTGTCGGCCATGGAAAACCTAATCACCTATGCTGTCCAGAAGGGC
CACCTGTCATCCAGTTATGTTCAGCCACTTCTTGGGAAAGGCGAGAACTGCCTGGCCCCT
CGGCAGAAGACAAGCCTGAAGAAGGCTTGCCCCGGCGTTGTCCCACGGTCTGTGTGGGGA
GCCAGGGAGACCCACTGTCCCAGGATGACTCTCCCAGCGAAGTATGGCATCATTATCCAC
ACTGCCGGGAGGACCTGCAACATTTCTGATGAGTGCCGCCTGCTGGTCCGGGACATCCAG
TCTTTCTACATAGACAGGCTCAAGTCATGCGACATTGGTTATAACTTCCTGGTGGGCCAG
GATGGCGCCATTTATGAAGGGGTGGGCTGGAATGTCCAAGGCTCCTCCACCCCTGGCTAC
GATGACATTGCCCTGGGCATTACCTTCATGGGCACCTTCACAGGTATACCACCCAATGCT
GCAGCACTAGAGGCAGCCCAAGACCTGATCCAGTGTGCCATGGTCAAAGGGTACCTGACT
CCCAACTACCTGCTGGTGGGCCACAGTGATGTGGCCCGAACCTTGTCTCCTGGGCAGGCT
TTGTACAACATCATCAGCACCTGGCCTCATTTCAAACACTGA
Protein Properties
Number of Residues 373
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Peptidoglycan recognition protein 4 (PGLYRP4 protein)
MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
WGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFL
VGDDGRVYEGVGWNIQGVHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKG
HLSSSYVQPLLGKGENCLAPRQKTSLKKACPGVVPRSVWGARETHCPRMTLPAKYGIIIH
TAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGY
DDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQA
LYNIISTWPHFKH
GenBank ID Protein 148744335
UniProtKB/Swiss-Prot ID Q96LB8
UniProtKB/Swiss-Prot Entry Name Q5SY64_HUMAN
PDB IDs
GenBank Gene ID BC142636
GeneCard ID Q5SY64
GenAtlas ID PGLYRP4
HGNC ID HGNC:30015
References
General References
  1. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]