You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09372
Secondary Accession Numbers
  • 15236
Name Hyaluronidase-1
Synonyms
  1. Hyal-1
  2. Hyaluronoglucosaminidase-1
  3. LuCa-1
  4. Lung carcinoma protein 1
Gene Name HYAL1
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Pathways
  • Glycosaminoglycan degradation
  • Lysosome
Reactions
+ Water → DWA-2 + N-Acetylgalactosamine details
+ Water → DWA-2 + N-Acetylgalactosamine 4-sulphate details
GO Classification
Biological Process
cellular response to pH
cellular response to UV-B
positive regulation of cell adhesion
cellular response to fibroblast growth factor stimulus
positive regulation of epithelial cell migration
inflammatory response
response to reactive oxygen species
cellular response to tumor necrosis factor
hyaluronan catabolic process
positive regulation of S phase of mitotic cell cycle
response to virus
cellular response to interleukin-1
positive regulation of angiogenesis
cellular response to platelet-derived growth factor stimulus
hyaluronan biosynthetic process
positive regulation of hyaluranon cable assembly
positive regulation of cell growth
negative regulation of cell growth
cartilage development
response to antibiotic
positive regulation of epithelial cell proliferation
negative regulation of cell proliferation
carbohydrate metabolic process
cell death
chondroitin sulfate catabolic process
Cellular Component
lysosomal lumen
hyaluranon cable
extracellular space
cytoplasmic vesicle
Function
hyalurononglucosaminidase activity
hexosaminidase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
Molecular Function
hyalurononglucosaminidase activity
transcription factor binding
hyaluronan synthase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Lysosome
  2. Secreted
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs HYAL1
Gene Sequence
>1308 bp
ATGGCAGCCCACCTGCTTCCCATCTGCGCCCTCTTCCTGACCTTACTCGATATGGCCCAA
GGCTTTAGGGGCCCCTTGCTACCCAACCGGCCCTTCACCACCGTCTGGAATGCAAACACC
CAGTGGTGCCTGGAGAGGCACGGTGTGGACGTGGATGTCAGTGTCTTCGATGTGGTAGCC
AACCCAGGGCAGACCTTCCGCGGCCCTGACATGACAATTTTCTATAGCTCCCAGCTGGGC
ACCTACCCCTACTACACGCCCACTGGGGAGCCTGTGTTTGGTGGTCTGCCCCAGAATGCC
AGCCTGATTGCCCACCTGGCCCGCACATTCCAGGACATCCTGGCTGCCATACCTGCTCCT
GACTTCTCAGGGCTGGCAGTCATCGACTGGGAGGCATGGCGCCCACGCTGGGCCTTCAAC
TGGGACACCAAGGACATTTACCGGCAGCGCTCACGGGCACTGGTACAGGCACAGCACCCT
GATTGGCCAGCTCCTCAGGTGGAGGCAGTAGCCCAGGACCAGTTCCAGGGAGCTGCACGG
GCCTGGATGGCAGGCACCCTCCAGCTGGGGCGGGCACTGCGTCCTCGCGGCCTCTGGGGC
TTCTATGGCTTCCCTGACTGCTACAACTATGACTTTCTAAGCCCCAACTACACCGGCCAG
TGCCCATCAGGCATCCGTGCCCAAAATGACCAGCTAGGGTGGCTGTGGGGCCAGAGCCGT
GCCCTCTATCCCAGCATCTACATGCCCGCAGTGCTGGAGGGCACAGGGAAGTCACAGATG
TATGTGCAACACCGTGTGGCCGAGGCATTCCGTGTGGCTGTGGCTGCTGGTGACCCCAAT
CTGCCGGTGCTGCCCTATGTCCAGATCTTCTATGACACGACAAACCACTTTCTGCCCCTG
GATGAGCTGGAGCACAGCCTGGGGGAGAGTGCGGCCCAGGGGGCAGCTGGAGTGGTGCTC
TGGGTGAGCTGGGAAAATACAAGAACCAAGGAATCATGTCAGGCCATCAAGGAGTATATG
GACACTACACTGGGGCCCTTCATCCTGAACGTGACCAGTGGGGCCCTTCTCTGCAGTCAA
GCCCTGTGCTCCGGCCATGGCCGCTGTGTCCGCCGCACCAGCCACCCCAAAGCCCTCCTC
CTCCTTAACCCTGCCAGTTTCTCCATCCAGCTCACGCCTGGTGGTGGGCCCCTGAGCCTG
CGGGGTGCCCTCTCACTTGAAGATCAGGCACAGATGGCTGTGGAGTTCAAATGTCGATGC
TACCCTGGCTGGCAGGCACCGTGGTGTGAGCGGAAGAGCATGTGGTGA
Protein Properties
Number of Residues 435
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Hyaluronidase-1
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q12794
UniProtKB/Swiss-Prot Entry Name HYAL1_HUMAN
PDB IDs
GenBank Gene ID U03056
GeneCard ID HYAL1
GenAtlas ID HYAL1
HGNC ID HGNC:5320
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  3. Wei MH, Latif F, Bader S, Kashuba V, Chen JY, Duh FM, Sekido Y, Lee CC, Geil L, Kuzmin I, Zabarovsky E, Klein G, Zbar B, Minna JD, Lerman MI: Construction of a 600-kilobase cosmid clone contig and generation of a transcriptional map surrounding the lung cancer tumor suppressor gene (TSG) locus on human chromosome 3p21.3: progress toward the isolation of a lung cancer TSG. Cancer Res. 1996 Apr 1;56(7):1487-92. [PubMed:8603390 ]
  4. Frost GI, Csoka AB, Wong T, Stern R: Purification, cloning, and expression of human plasma hyaluronidase. Biochem Biophys Res Commun. 1997 Jul 9;236(1):10-5. [PubMed:9223416 ]
  5. Frost GI, Mohapatra G, Wong TM, Csoka AB, Gray JW, Stern R: HYAL1LUCA-1, a candidate tumor suppressor gene on chromosome 3p21.3, is inactivated in head and neck squamous cell carcinomas by aberrant splicing of pre-mRNA. Oncogene. 2000 Feb 17;19(7):870-7. [PubMed:10702795 ]
  6. Lokeshwar VB, Schroeder GL, Carey RI, Soloway MS, Iida N: Regulation of hyaluronidase activity by alternative mRNA splicing. J Biol Chem. 2002 Sep 13;277(37):33654-63. Epub 2002 Jun 25. [PubMed:12084718 ]
  7. Chao KL, Muthukumar L, Herzberg O: Structure of human hyaluronidase-1, a hyaluronan hydrolyzing enzyme involved in tumor growth and angiogenesis. Biochemistry. 2007 Jun 12;46(23):6911-20. Epub 2007 May 16. [PubMed:17503783 ]
  8. Triggs-Raine B, Salo TJ, Zhang H, Wicklow BA, Natowicz MR: Mutations in HYAL1, a member of a tandemly distributed multigene family encoding disparate hyaluronidase activities, cause a newly described lysosomal disorder, mucopolysaccharidosis IX. Proc Natl Acad Sci U S A. 1999 May 25;96(11):6296-300. [PubMed:10339581 ]