You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09381
Secondary Accession Numbers
  • 15249
Name Type III iodothyronine deiodinase
Synonyms
  1. 5DIII
  2. DIOIII
  3. Type 3 DI
  4. Type-III 5'-deiodinase
Gene Name DIO3
Protein Type Enzyme
Biological Properties
General Function Involved in thyroxine 5'-deiodinase activity
Specific Function Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
Pathways Not Available
Reactions
Liothyronine + I(-) + A + Hydrogen Ion → Thyroxine + AH(2) details
GO Classification
Biological Process
cellular nitrogen compound metabolic process
hormone biosynthetic process
thyroid hormone generation
Cellular Component
plasma membrane
endosome membrane
integral to membrane
Function
catalytic activity
thyroxine 5'-deiodinase activity
oxidoreductase activity
Molecular Function
thyroxine 5'-deiodinase activity
thyroxine 5-deiodinase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Cell membrane
  2. Endosome membrane
  3. Single-pass type II membrane protein
  4. Single-pass type II membrane protein
Gene Properties
Chromosome Location 14
Locus 14q32
SNPs DIO3
Gene Sequence
>837 bp
ATGCTCCGCTCCCTGCTGCTTCACTCCTTGAGGCTCTGCGCCCAGACCGCCTCGTGCCTC
GTGCTCTTCCCGCGCTTCCTCGGCACGGCCTTCATGCTCTGGCTTCTCGATTTCTTGTGT
ATCCGCAAGCATTTCCTGGGCCGCCGCCGCCGGGGGCAGCCCGAGCCCGAAGTGGAGCTC
AACAGTGAAGGCGAGGAGGTGCCTCCCGATGACCCGCCCATCTGCGTGTCCGACGACAAC
CGCCTGTGCACCCTGGCGTCGCTCAAGGCGGTGTGGCATGGCCAGAAGTTGGATTTCTTC
AAGCAGGCGCACGAGGGCGGTCCGGCGCCCAACTCCGAGGTGGTTCTGCCCGACGGCTTC
CAGAGCCAGCACATCCTCGACTACGCGCAAGGGAACCGCCCGCTGGTTCTCAATTTCGGC
AGCTGCACCTGACCACCGTTCATGGCGCGCATGAGCGCCTTCCAGCGCCTGGTCACTAAG
TACCAGCGCGACGTCGACTTCCTCATCATCTACATCGAGGAAGCGCACCCCTCCGACGGC
TGGGTCACCACGGACTCTCCCTACATCATCCCACAGCACCGGAGCCTGGAGGACCGGGTC
AGCGCAGCGAGGGTACTGCAGCAAGGTGCACCCGGCTGCGCTCTGGTCCTCGACACCATG
GCCAACTCCAGCAGCTCGGCCTATGGCGCCTACTTCGAGCGTCTCTATGTCATCCAGAGT
GGCACTATTATGTACCAGGGCGGCCGTGGCCCCGACGGCTACCAGGTCTCTGAGCTGCGC
ACTTGGTTGGAACGCTATGATGAGCAACTGCACGGCGCTCGGCCCCGGAGGGTGTAA
Protein Properties
Number of Residues 278
Molecular Weight 33947.175
Theoretical pI 6.719
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Type III iodothyronine deiodinase
MLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVEL
NSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGF
QSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDG
WVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQS
GTIMYQGGRGPDGYQVSELRTWLERYDEQLHGARPRRV
GenBank ID Protein 56103188
UniProtKB/Swiss-Prot ID P55073
UniProtKB/Swiss-Prot Entry Name IOD3_HUMAN
PDB IDs Not Available
GenBank Gene ID BC017717
GeneCard ID DIO3
GenAtlas ID DIO3
HGNC ID HGNC:2885
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Salvatore D, Low SC, Berry M, Maia AL, Harney JW, Croteau W, St Germain DL, Larsen PR: Type 3 lodothyronine deiodinase: cloning, in vitro expression, and functional analysis of the placental selenoenzyme. J Clin Invest. 1995 Nov;96(5):2421-30. [PubMed:7593630 ]
  4. Baqui M, Botero D, Gereben B, Curcio C, Harney JW, Salvatore D, Sorimachi K, Larsen PR, Bianco AC: Human type 3 iodothyronine selenodeiodinase is located in the plasma membrane and undergoes rapid internalization to endosomes. J Biol Chem. 2003 Jan 10;278(2):1206-11. Epub 2002 Nov 4. [PubMed:12419801 ]