You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09388
Secondary Accession Numbers
  • 15259
Name Gamma-glutamylcyclotransferase
Synonyms
  1. Cytochrome c-releasing factor 21
Gene Name GGCT
Protein Type Enzyme
Biological Properties
General Function Involved in acyltransferase activity
Specific Function Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis.
Pathways
  • 5-oxoprolinase deficiency
  • 5-Oxoprolinuria
  • Gamma-glutamyl-transpeptidase deficiency
  • Gamma-Glutamyltransferase Deficiency
  • Glutathione Metabolism
  • Glutathione metabolism
  • Glutathione Synthetase Deficiency
Reactions
(Gamma-L-glutamyl)-L-amino acid → Pyrrolidonecarboxylic acid + L-amino acid details
gamma-Glutamylcysteine → Pyroglutamic acid + L-Cysteine details
(5-L-Glutamyl)-L-amino acid → Pyroglutamic acid + L-Amino acid details
GO Classification
Biological Process
xenobiotic metabolic process
glutathione biosynthetic process
release of cytochrome c from mitochondria
Cellular Component
cytosol
Molecular Function
protein homodimerization activity
gamma-glutamylcyclotransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7p15-p14
SNPs GGCT
Gene Sequence
>567 bp
ATGGCCAACTCGGGCTGCAAGGACGTCACGGGTCCAGATGAGGAGAGTTTTCTGTACTTT
GCCTACGGCAGCAACCTGCTGACAGAGAGGATCCACCTCCGAAACCCCTCGGCGGCGTTC
TTCTGTGTGGCCCGCCTGCAGGATTTTAAGCTTGACTTTGGCAATTCCCAAGGCAAAACA
AGTCAAACTTGGCATGGAGGGATAGCCACCATTTTTCAGAGTCCTGGCGATGAAGTGTGG
GGAGTAGTATGGAAAATGAACAAAAGCAATTTAAATTCTCTGGATGAGCAAGAAGGGGTT
AAAAGTGGAATGTATGTTGTAATAGAAGTTAAAGTTGCAACTCAAGAAGGAAAAGAAATA
ACCTGTCGAAGTTATCTGATGACAAATTACGAAAGTGCTCCCCCATCCCCACAGTATAAA
AAGATTATTTGCATGGGTGCAAAAGAAAATGGTTTGCCGCTGGAGTATCAAGAGAAGTTA
AAAGCAATAGAACCAAATGACTATACAGGAAAGGTCTCAGAAGAAATTGAAGACATCATC
AAAAAGGGGGAAACACAAACTCTTTAG
Protein Properties
Number of Residues 188
Molecular Weight 19091.635
Theoretical pI 9.493
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Gamma-glutamylcyclotransferase
MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKT
SQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEI
TCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII
KKGETQTL
GenBank ID Protein 189054993
UniProtKB/Swiss-Prot ID O75223
UniProtKB/Swiss-Prot Entry Name GGCT_HUMAN
PDB IDs
GenBank Gene ID AK315608
GeneCard ID GGCT
GenAtlas ID GGCT
HGNC ID HGNC:21705
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Masuda Y, Maeda S, Watanabe A, Sano Y, Aiuchi T, Nakajo S, Itabe H, Nakaya K: A novel 21-kDa cytochrome c-releasing factor is generated upon treatment of human leukemia U937 cells with geranylgeraniol. Biochem Biophys Res Commun. 2006 Jul 28;346(2):454-60. [PubMed:16765912 ]
  4. Oakley AJ, Yamada T, Liu D, Coggan M, Clark AG, Board PG: The identification and structural characterization of C7orf24 as gamma-glutamyl cyclotransferase. An essential enzyme in the gamma-glutamyl cycle. J Biol Chem. 2008 Aug 8;283(32):22031-42. doi: 10.1074/jbc.M803623200. Epub 2008 May 30. [PubMed:18515354 ]
  5. Bae E, Bingman CA, Aceti DJ, Phillips GN Jr: Crystal structure of Homo sapiens protein LOC79017. Proteins. 2008 Feb 1;70(2):588-91. [PubMed:17932939 ]