You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09421
Secondary Accession Numbers
  • 15298
Name Calcium/calmodulin-dependent protein kinase isoform A
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in calmodulin-dependent protein kinase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
calmodulin binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
calmodulin-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>918 bp
CTGAAACATCCAAACATCGTGCGCCTCCATGACAGTATTTCTGAAGAAGGGTTTCACTAC
CTCGTGTTTGACCTTGTTACGGGAGGGGAGCTGTTTGAAGACATCGTGGCCAGAGAGTAC
TACAGTGAAGCTGATGCCAGCCACTGTATACATCAGATTCTGGAGAGTGTTAACCACATC
CACCAGCATGACATCGTCCACAGGGACCTGAAGCCTGAGAACCTGCTGCTGGCGAGTAAA
TGCAAGGGTGCCGCCGTCAAGCTGGCTGATTTTGGCCTAGCCATCGAAGTACAGGGAGAG
CAGCAGGCTTGGTTTGGTTTTGCTGGCACCCCAGGTTACTTGTCCCCTGAGGTCTTGAGG
AAAGATCCCTATGGAAAACCTGTGGATATCTGGGCCTGCGGGGTCATCCTGTATATCCTC
CTGGTGGGCTACCCTCCCTTCTGGGATGAGGATCAGCACAAGCTGTATCAGCAGATCAAG
GCTGGAACCTATGATTTCCCATCACCAGAATGGGACACGGTAACTCCTGAAGCCAAGAAC
TTGATCAACCAGATGCTGACCATAAACCCAGCAAAGCGCATCACGGCTGACCAGGCTCTC
AAGCACCCGTGGGTCTGTCAACGATCCACGGTGGCATCCATGATGCATCGTCAGGAGACT
GTGGAGTGTTTGCGCAAGTTCAATGCCCGGAGAAAACTGAAGGGTGCCATCCTCACGACC
ATGCTTGTCTCCAGGAACTTCTCAGCTGCCAAAAGCCTATTGAACAAGAAGTCGGATGGC
GGTGTCAAGGAGCCACAAACCACTGTGGTACACAACGCTACAGATGGGATCAAGGGCTCC
ACAGAGAGCTGCAACACCACCACAGAAGATGAGGACCTCAAAGTGCGAAAACAGGAGATC
ATTAAGATTACAGAACAG
Protein Properties
Number of Residues 306
Molecular Weight 34523.1
Theoretical pI 6.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calcium/calmodulin-dependent protein kinase isoform A
MKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHI
HQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLR
KDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGTYDFPSPEWDTVTPEAKN
LINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTT
MLVSRNFSAAKSLLNKKSDGGVKEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEI
IKITEQ
GenBank ID Protein 2204281
UniProtKB/Swiss-Prot ID Q13555
UniProtKB/Swiss-Prot Entry Name O00561_HUMAN
PDB IDs Not Available
GenBank Gene ID L07043
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:1463
References
General References
  1. Nghiem P, Saati SM, Martens CL, Gardner P, Schulman H: Cloning and analysis of two new isoforms of multifunctional Ca2+/calmodulin-dependent protein kinase. Expression in multiple human tissues. J Biol Chem. 1993 Mar 15;268(8):5471-9. [PubMed:8449910 ]