You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09441
Secondary Accession Numbers
  • 15322
Name Inositol-pentakisphosphate 2-kinase
Synonyms
  1. IPK1 homolog
  2. Inositol-1,3,4,5,6-pentakisphosphate 2-kinase
  3. Ins(1,3,4,5,6)P5 2-kinase
  4. InsP5 2-kinase
Gene Name IPPK
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.
Pathways
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
  • Phosphatidylinositol signaling system
Reactions
Adenosine triphosphate + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate → ADP + 1D-myo-inositol hexakisphosphate details
Myo-inositol hexakisphosphate + ADP → Inositol 1,3,4,5,6-pentakisphosphate + Adenosine triphosphate details
GO Classification
Biological Process
inositol phosphorylation
Cellular Component
intracellular
cytoplasm
nucleus
Function
binding
catalytic activity
inositol pentakisphosphate 2-kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
inositol or phosphatidylinositol kinase activity
Molecular Function
ATP binding
inositol pentakisphosphate 2-kinase activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 9
Locus 9q22.31
SNPs IPPK
Gene Sequence
>1476 bp
ATGGAAGAGGGGAAGATGGACGAGAATGAATGGGGGTACCACGGAGAGGGCAATAAGAGC
CTGGTGGTGGCCCACGCGCAGCGCTGCGTCGTGCTGCGGTTTCTGAAGTTTCCTCCAAAT
AGGAAGAAGACCTCGGAAGAGATATTTCAACACCTGCAGAACATAGTGGACTTTGGGAAA
AATGTCATGAAGGAGTTTTTGGGGGAGAACTATGTTCATTATGGGGAGGTCGTTCAGCTA
CCTTTAGAGTTTGTGAAACAGCTTTGTTTAAAGATACAATCTGAAAGACCAGAGTCTCGC
TGTGACAAGGACCTGGATACTCTCAGTGGTTACGCTATGTGCCTTCCTAATTTAACCAGA
CTCCAAACCTACCGCTTTGCAGAGCACCGGCCGATTCTGTGTGTAGAGATTAAGCCAAAA
TGTGGGTTTATTCCTTTCTCGAGTGATGTCACGCATGAGATGAAGCATAAGGTCTGTCGA
TACTGCATGCACCAGCACCTCAAGGTAGCAACTGGGAAGTGGAAGCAGATCAGCAAATAC
TGTCCCCTTGATCTCTACTCAGGAAACAAACAGAGAATGCACTTTGCCTTGAAGAGTTTG
CTGCAGGAGGCACAGAACAACTTGAAGATATTTAAGAATGGTGAGCTGATTTACGGCTGC
AAAGATGCCCGGAGCCCCGTGGCTGACTGGAGCGAGCTTGCACACCACCTGAAGCCGTTC
TTCTTCCCTTCCAACGGCCTGGCCAGTGGGCCCCACTGCACAAGGGCTGTGATCAGGGAG
CTGGTGCACGTGATCACACGGGTGCTGCTGAGTGGCTCGGACAAGGGCCGGGCAGGCACC
CTGAGTCCGGGGCTCGGGCCTCAGGGCCCGCGAGTCTGCGAAGCCAGCCCTTTCAGTAGG
AGCCTTCGCTGCCAAGGAAAAAACACCCCAGAGCGCTCGGGGTTACCGAAGGGCTGTCTT
CTGTACAAAACCCTCCAGGTGCAGATGTTGGACCTGCTGGACATCGAAGGCCTCTACCCT
CTGTACAACCGGGTTGAGCGATACCTGGAAGAGTTTCCCGAGGAGAGAAAAACCTTACAA
ATAGATGGGCCTTATGATGAAGCATTTTACCAGAAGCTGCTTGACCTTTCCACTGAGGAT
GACGGGACAGTGGCCTTCGCGCTAACGAAGGTGCAGCAGTACCGCGTCGCCATGACTGCC
AAGGACTGCTCCATCATGATTGCACTGTCTCCCTGTCTGCAGGATGCCAGCTCTGATCAA
AGGCCTGTCGTCCCTTCATCGAGGTCCAGGTTTGCCTTTTCCGTGTCTGTGCTGGACCTT
GACCTCAAGCCCTACGAGAGCATTCCCCATCAGTATAAACTGGACGGCAAGATCGTCAAC
TATTATTCAAAGACTGTACGTGCCAAAGACAACGCCGTGATGTCGACTCGGTTCAAGGAA
AGCGAAGATTGCACATTAGTTCTCCACAAGGTCTAA
Protein Properties
Number of Residues 491
Molecular Weight 56016.12
Theoretical pI 8.364
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol-pentakisphosphate 2-kinase
MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGK
NVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTR
LQTYRFAEHRPILCVEIKPKCGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKY
CPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCKDARSPVADWSELAHHLKPF
FFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGTLSPGLGPQGPRVCEASPFSR
SLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQ
IDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKE
SEDCTLVLHKV
GenBank ID Protein 14582858
UniProtKB/Swiss-Prot ID Q9H8X2
UniProtKB/Swiss-Prot Entry Name IPPK_HUMAN
PDB IDs Not Available
GenBank Gene ID AF351202
GeneCard ID IPPK
GenAtlas ID IPPK
HGNC ID HGNC:14645
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. Verbsky JW, Wilson MP, Kisseleva MV, Majerus PW, Wente SR: The synthesis of inositol hexakisphosphate. Characterization of human inositol 1,3,4,5,6-pentakisphosphate 2-kinase. J Biol Chem. 2002 Aug 30;277(35):31857-62. Epub 2002 Jun 25. [PubMed:12084730 ]
  5. Verbsky J, Majerus PW: Increased levels of inositol hexakisphosphate (InsP6) protect HEK293 cells from tumor necrosis factor (alpha)- and Fas-induced apoptosis. J Biol Chem. 2005 Aug 12;280(32):29263-8. Epub 2005 Jun 20. [PubMed:15967797 ]