You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09467
Secondary Accession Numbers
  • 15356
Name Dual serine/threonine and tyrosine protein kinase
Synonyms
  1. Dusty PK
  2. Dusty protein kinase
  3. RIP-homologous kinase
  4. Receptor-interacting serine/threonine-protein kinase 5
  5. SgK496
  6. Sugen kinase 496
Gene Name DSTYK
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function May induce both caspase-dependent apoptosis and caspase- independent cell death
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32.1
SNPs DSTYK
Gene Sequence
>2790 bp
ATGGAGGGCGACGGGGTGCCATGGGGCAGCGAGCCCGTCTCGGGTCCCGGCCCCGGCGGC
GGCGGAATGATCCGCGAGCTGTGCCGGGGCTTCGGCCGCTACCGCCGCTACCTGGGACGG
CTGCGACAGAACCTGCGCGAGACCCAGAAGTTCTTCCGCGACATCAAGTGCTCCCACAAC
CACACTTGTCTCTCCTCCCTCACGGGCGGCGGCGGGGCCGAGCGCGGCCCTGCAGGCGAT
GTCGCCGAAACCGGGCTGCAGGCGGGCCAACTGAGCTGCATTTCCTTCCCACCTAAGGAA
GAGAAGTACCTCCAGCAGATTGTGGACTGCCTCCCTTGCATACTGATCCTCGGCCAGGAT
TGTAACGTCAAGTGCCAGCTGTTGAATCTGCTGTTGGGGGTGCAGGTGCTTCCCACCACC
AAGCTGGGCAGTGAGGAGAGCTGTAAGCTTCGGCGCCTCCGCTTCACCTATGGGACTCAG
ACTCGGGTCAGCCTGGCGCTCCCTGGACAGTATGAACTAGTGCACACGCTGGTTGCTCAT
CAGGGCAACTGGGAGACCATCCCTGAGGAGGATCTGGAGGTCCAAGAGAACAATGAGGAT
GCTGCTCATGTTTTAGCGGAACTGGAGGTAACGATGCACCATGCTCTCTTACAGGAAGTG
GACGTTGTGGTAGCACCATGCCAAGGCCTCCGGCCCACAGTGGATGTTCTGGGTGACTTG
GTGAATGATTTCTTGCCTGTGATAACCTATGCACTCCACAAAGATGAACTCTCTGAGAGG
GATGAGCAAGAGCTTCAGGAAATCCGAAAGTATTTCTCCTTTCCTGTATTCTTTTTCAAA
GTGCCGAAACTGGGCTCGGAGATAATAGACTCCTCAACCAGGAGAATGGAGAGCGAAAGA
TCACCGCTTTATCGCCAGCTAATTGACCTGGGCTATCTGAGCAGCAGTCACTGGAACTGT
GGGGCTCCTGGCCAGGATACTAAAGCTCAGAGCATGTTGGTGGAACAGAGTGAAAAGCTG
AGACACTTGAGCACATTTTCTCACCAGGTGTTACAGACTCGCCTGGTGGATGCAGCCAAG
GCCCTGAACCTGGTGCACTGCCACTGCCTTGACATCTTTATTAACCAGGCATTTGACATG
CAGCGGGACCTGCAGATCACTCCCAAACGTCTGGAATATACTCGAAAAAAGGAGAATGAG
TTGTATGAATCATTGATGAATATTGCCAACCGAAAGCAGGAGGAAATGAAGGATATGATT
GTTGAGACACTTAATACCATGAAGGAGGAACTTCTGGATGATGCTACTAACATGGAGTTT
AAAGACGTCATTGTCCCTGAGAATGGAGAACCAGTAGGCACCAGAGAGATCAAATGCTGC
ATCCGACAGATCCAGGAACTCATCATCTCCCGACTTAATCAGGCAGTGGCTAATAAGCTG
ATCAGCTCAGTGGATTACCTGAGGGAAAGCTTCGTCGGAACCCTGGAACGATGTCTGCAG
AGCCTGGAGAAGTCTCAGGATGTCTCAGTTCACATCACCAGTAATTATCTCAAACAGATC
TTAAATGCTGCCTATCATGTTGAAGTCACGTTTCACTCAGGGTCGTCAGTTACAAGGATG
CTATGGGAGCAAATCAAACAGATCATCCAGCGCATCACATGGGTGAGCCCACCTGCCATC
ACTCTGGAATGGAAGAGGAAGGTGGCCCAGGAAGCCATTGAGAGCCTCAGCGCCTCCAAA
TTGGCTAAGAGCATTTGCAGCCAATTCCGGACTCGGCTCAATAGTTCCCACGAGGCTTTT
GCAGCCTCCTTGCGGCAGCTGGAAGCTGGCCACTCAGGCCGGTTAGAGAAAACGGAAGAT
CTATGGCTGAGGGTTCGGAAAGATCATGCTCCCCGCCTGGCCCGCCTTTCTCTGGAAAGC
TGTTCTTTACAGGATGTCTTGCTTCATCGTAAACCTAAACTGGGACAGGAACTGGGCCGG
GGCCAGTATGGTGTGGTATACCTGTGTGACAACTGGGGAGGACACTTCCCTTGTGCCCTC
AAATCAGTTGTCCCTCCAGATGAGAAGCACTGGAATGATCTGGCTTTGGAATTTCACTAT
ATGAGGTCTCTGCCGAAGCATGAGCGATTGGTGGATCTCCATGGTTCAGTCATTGACTAC
AACTATGGTGGTGGCTCCAGCATTGCTGTGCTCCTCATTATGGAGCGGCTACACCGGGAT
CTCTACACAGGGCTGAAGGCTGGGCTGACCCTGGAGACACGTTTGCAGATAGCACTAGAT
GTGGTGGAGGGAATCCGCTTCCTGCACAGCCAGGGACTTGTCCATCGTGATATCAAACTG
AAAAATGTGCTGCTGGATAAGCAGAACCGTGCCAAGATCACTGACTTAGGATTCTGCAAG
CCAGAGGCCATGATGTCAGGCAGCATTGTGGGGACACCAATCCATATGGCCCCTGAACTT
TTCACAGGGAAGTACGATAATTCCGTGGATGTCTACGCTTTTGGAATTCTTTTCTGGTAT
ATCTGCTCAGGCTCTGTCAAGCTCCCTGAGGCATTTGAGAGGTGTGCTAGCAAAGACCAT
CTCTGGAACAATGTGCGGAGGGGGGCTCGCCCAGAACGTCTTCCTGTGTTTGATGAGGAG
TGCTGGCAGTTGATGGAAGCCTGTTGGGATGGCGACCCCTTGAAGAGGCCTCTCTTGGGC
ATTGTCCAGCCCATGCTCCAGGGCATCATGAATCGGCTCTGCAAGTCCAATTCTGAGCAG
CCAAACAGAGGACTAGATGATTCTACTTGA
Protein Properties
Number of Residues 929
Molecular Weight 105204.7
Theoretical pI 6.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dual serine/threonine and tyrosine protein kinase
MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHN
HTCLSSLTGGGGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQD
CNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAH
QGNWETIPEEDLEVQENNEDAAHVLAELEVTMHHALLQEVDVVVAPCQGLRPTVDVLGDL
VNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFKVPKLGSEIIDSSTRRMESER
SPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQVLQTRLVDAAK
ALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKL
ISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRM
LWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAF
AASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGR
GQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDY
NYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKL
KNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLG
IVQPMLQGIMNRLCKSNSEQPNRGLDDST
GenBank ID Protein 40806179
UniProtKB/Swiss-Prot ID Q6XUX3
UniProtKB/Swiss-Prot Entry Name DUSTY_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015375.2
GeneCard ID DSTYK
GenAtlas ID DSTYK
HGNC ID HGNC:29043
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Seki N, Ohira M, Nagase T, Ishikawa K, Miyajima N, Nakajima D, Nomura N, Ohara O: Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. DNA Res. 1997 Oct 31;4(5):345-9. [PubMed:9455484 ]
  5. Peng J, Dong W, Chen Y, Mo R, Cheng JF, Hui CC, Mohandas N, Huang CH: Dusty protein kinases: primary structure, gene evolution, tissue specific expression and unique features of the catalytic domain. Biochim Biophys Acta. 2006 Nov-Dec;1759(11-12):562-72. Epub 2006 Oct 21. [PubMed:17123648 ]
  6. Zha J, Zhou Q, Xu LG, Chen D, Li L, Zhai Z, Shu HB: RIP5 is a RIP-homologous inducer of cell death. Biochem Biophys Res Commun. 2004 Jun 25;319(2):298-303. [PubMed:15178406 ]