You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09469
Secondary Accession Numbers
  • 15358
Name Serine/threonine-protein kinase ULK3
Synonyms
  1. Unc-51-like kinase 3
Gene Name ULK3
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q24.1
SNPs ULK3
Gene Sequence
>1419 bp
ATGGCGGGGCCCGGCTGGGGTCCCCCGCGCCTGGACGGCTTCATCCTCACCGAGCGCCTG
GGCAGCGGCACGTACGCCACGGTGTACAAGGCCTACGCCAAGAAGGACACTCGTGAAGTG
GTAGCCATAAAGTGTGTAGCCAAGAAAAGTCTGAACAAGGCATCGGTGGAGAACCTCCTC
ACGGAGATTGAGATCCTCAAGGGCATTCGACATCCCCACATTGTGCAGCTGAAAGACTTT
CAGTGGGACAGTGACAATATCTACCTCATCATGGAGTTTTGCGCAGGGGGCGACCTGTCT
CGCTTCATCCATACCCGCAGGATTCTGCCTGAGAAGGTGGCGCGTGTCTTCATGCAGCAA
TTAGCTAGCGCCCTGCAATTCCTGCATGAACGGAATATCTCTCACCTGGATCTGAAGCCA
CAGAACATTCTACTGAGCTCCTTGGAGAAGCCCCACCTAAAACTGGCAGACTTTGGTTTC
GCACAACACATGTCCCCGTGGGATGAGAAGCACGTGCTCCGTGGCTCCCCCCTCTACATG
GCCCCCGAGATGGTGTGCCAGCGGCAGTATGACGCCCGCGTGGACCTCTGGTCCATGGGG
GTCATCCTGTATGAAGCCCTCTTCGGGCAGCCCCCCTTTGCCTCCAGGTCGTTCTCGGAG
CTGGAAGAGAAGATCCGTAGCAACCGGGTCATCGAGCTCCCCTTGCGGCCCCTGCTCTCC
CGAGACTGCCGGGACCTACTGCAGCGGCTCCTGGAGCGGGACCCCAGCCGTCGCATCTCC
TTCCAGGACTTTTTTGCGCACCCCTGGGTGGACCTGGAGCACATGCCCAGTGGGGAGAGT
CTGGGGCGAGCAACCGCCCTGGTGGTGCAGGCTGTGAAGAAAGACCAGGAGGGGGATTCA
GCAGCTGCCTTATCACTCTACTGCAAGGCTCTGGACTTCTTTGTACCTGCCCTGCACTAT
GAAGTGGATGCCCAGCGGAAGGAGGCAATTAAGGCAAAGGTGGGGCAGTACGTGTCCCGG
GCTGAGGAGCTCAAGGCCATCGTCTCCTCTTCCAATCAGGCCCTGCTGAGGCAGGGGACC
TCTGCCCGAGACCTGCTCAGAGAGATGGCCCGGGACAAGCCACGCCTCCTAGCTGCCCTG
GAAGTGGCTTCAGCTGCCATGGCCAAGGAGGAGGCCGCCGGCGGGGAGCAGGATGCCCTG
GACCTGTACCAGCACAGCCTGGGGGAGCTACTGCTGTTGCTGGCAGCGGAGCCCCCGGGC
CGGAGGCGGGAGCTGCTTCACACTGAGGTTCAGAACCTCATGGCCCGAGCTGAATACTTG
AAGGAGCAGGTCAAGATGAGGGAATCTCGCTGGGAAGCTGACACCCTGGACAAAGAGGGA
CTGTCGGAATCTGTTCGTAGCTCTTGCACCCTTCAGTGA
Protein Properties
Number of Residues 472
Molecular Weight 53443.9
Theoretical pI 7.39
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase ULK3
MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL
TEIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQ
LASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYM
APEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPLLS
RDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGESLGRATALVVQAVKKDQEGDS
AAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSSSNQALLRQGT
SARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPG
RRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ
GenBank ID Protein 150456432
UniProtKB/Swiss-Prot ID Q6PHR2
UniProtKB/Swiss-Prot Entry Name ULK3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001099436.1
GeneCard ID ULK3
GenAtlas ID ULK3
HGNC ID HGNC:19703
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]