You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09470
Secondary Accession Numbers
  • 15359
Name SFRS protein kinase 3
Synonyms
  1. SubName: cDNA FLJ58116, highly similar to Homo sapiens serine/threonine kinase 23 (STK23), mRNA
Gene Name SRPK3
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SRPK3
Gene Sequence
>1704 bp
ATGAGCGCCAGCACGGGCGGTGGTGGGGACAGCGGCGGCAGCGGCGGCAGTAGCAGCAGC
TCACAGGCCTCCTGCGGGCCCGAGTCCTCGGGCTCCGAACTAGCCCTGGCCACACCGGTG
CCTCAGATGCTGCAGGGCCTTCTGGGCTCCGACGACGAGGAACAGGAAGACCCCAAAGAC
TACTGCAAGGGCGGCTACCACCCTGTGAAGATCGGCGACGTGTTCAATGGGCGGTACCAC
GTGGTGCGCAAACTGGGCTGGGGCCACTTCTCCACCGTCTGGCTCTGCTGGGACATCCAG
CGCAAGCGCTTTGTGGCCCTCAAAGTGGTGAAGAGTGCGGGGCATTACACGGAGACAGCT
GTGGATGAGATCAAGCTCCTGAAATGTGTCCGGGACAGCGACCCCAGTGACCCCAAAAGA
GAGACCATTGTCCAGCTCATTGATGACTTCAGGATCTCAGGAGTCAATGGAGTCCATGTG
TGCATGGTGCTGGAGGTGCTGGGCCACCAGCTCCTCAAATGGATCATCAAGTCCAACTAC
CAGGGCCTGCCCGTGCCCTGCGTGAAGAGCATCGTGAGGCAGGTGCTGCACGGCCTGGAC
TACCTCCACACCAAGTGCAAGATCATCCACACGGACATCAAGCCCGAGAACATCTTGCTG
TGTGTGGGGGACGCTTACATCAGGCGCCTGGCTGCCGAGGCCACGGAGTGGCAACAGGCA
GGGGCGCCGCCCCCCTCCCGCTCCATAGTCAGCACTGCCCCCCAGGAGGTCTTGCAGACC
GGTAAGCTGTCCAAAAACAAGAGGAAGAAGATGAGGCGCAAACGGAAACAGCAGAAGCGG
CTGCTGGAGGAGCGGCTGCGGGACCTGCAGAGGCTGGAGGCCATGGAGGCTGCCACCCAG
GCTGAGGACTCTGGCTTGAGACTAGACGGGGGCAGCGGCTCCACATCCTCTTCAGGCTGT
CACCCCGGGGGCGCCAGAGCAGGTCCCTCCCCAGCCTCTTCCTCCCCCGCCCCGGGGGGC
GGCCGTAGCCTCAGCGCGGGCTCACAGACCTCAGGCTTCTCCGGCTCCCTCTTCTCTCCT
GCCTCCTGCTCCATCCTCTCCGGCTCGTCCAATCAGCGAGAGACCGGGGGCCTCCTGTCG
CCTAGCACACCATTCGGTGCCTCGAACCTCCTGGTGAACCCCCTGGAGCCCCAAAATGCA
GATAAGATCAAGATCAAGATCGCAGACCTGGGCAACGCCTGCTGGGTGCACAAGCACTTC
ACGGAAGACATCCAGACTCGGCAGTACCGGGCCGTCGAGGTGCTGATCGGCGCCGAATAC
GGCCCCCCGGCAGACATCTGGAGCACAGCCTGCATGGCCTTCGAGCTGGCCACTGGTGAC
TACCTGTTCGAGCCGCATTCTGGAGAAGACTACAGTCGTGATGAGGACCACATCGCTCAC
ATAGTGGAGCTTCTGGGGGACATCCCCCCAGCCTTCGCCCTCTCAGGCCGCTATTCCCGG
GAGTTCTTCAACCGGAGAGGAGAGCTGCGGCACATCCACAATCTCAAGCACTGGGGCCTG
TACGAGGTACTCATGGAAAAGTACGAGTGGCCCCTAGAGCAGGCCACACAGTTCAGCGCC
TTTCTGCTGCCCATGATGGAGTACATCCCCGAAAAGCGGGCCAGTGCCGCTGACTGCCTC
CAGCACCCCTGGCTCAACCCCTAG
Protein Properties
Number of Residues 567
Molecular Weight 62013.6
Theoretical pI 7.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>SFRS protein kinase 3
MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKD
YCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETA
VDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNY
QGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQA
GAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQ
AEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQTSGFSGSLFSP
ASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAH
IVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSA
FLLPMMEYIPEKRASAADCLQHPWLNP
GenBank ID Protein 194377696
UniProtKB/Swiss-Prot ID Q9UPE1
UniProtKB/Swiss-Prot Entry Name Q562F5_HUMAN
PDB IDs Not Available
GenBank Gene ID AK301749
GeneCard ID SRPK3
GenAtlas ID SRPK3
HGNC ID HGNC:11402
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]