Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09473
Secondary Accession Numbers
  • 15362
Name Interleukin-1 receptor-associated kinase-like 2
Synonyms
  1. IRAK-2
Gene Name IRAK2
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3p25.3
SNPs IRAK2
Gene Sequence
>1878 bp
ATGGCCTGCTACATCTACCAGCTGCCCTCCTGGGTGCTGGACGACCTGTGCCGCAACATG
GACGCGCTCAGCGAGTGGGACTGGATGGAGTTCGCCTCCTACGTGATCACAGACCTGACC
CAGCTGCGGAAGATCAAGTCCATGGAGCGGGTGCAGGGTGTGAGCATCACGCGGGAGCTG
CTGTGGTGGTGGGGCATGCGGCAGGCCACCGTCCAGCAACTTGTGGACCTCCTGTGCCGC
CTGGAGCTCTACCGGGCTGCCCAGATCATCCTGAACTGGAAACCGGCTCCTGAAATCAGG
TGTCCCATTCCAGCCTTCCCTGACTCTGTGAAGCCAGAAAAGCCTTTGGCAGCTTCTGTA
AGAAAGGCTGAGGATGAACAGGAAGAGGGGCAGCCTGTGAGGATGGCCACCTTTCCAGGC
CCAGGGTCCTCTCCAGCCAGAGCCCACCAGCCGGCCTTTCTCCAGCCTCCTGAAGAAGAT
GCCCCTCATTCCTTGAGAAGCGACCTCCCCACTTCGTCTGATTCAAAGGACTTCAGCACC
TCCATTCCTAAGCAGGAAAAACTTTTGAGCTTGGCTGGAGACAGCCTTTTCTGGAGTGAG
GCAGACGTGGTCCAGGCAACCGATGACTTCAATCAAAACCGCAAAATCAGCCAGGGGACC
TTTGCTGACGTCTACAGAGGGCACAGGCACGGGAAGCCATTCGTCTTCAAGAAGCTCAGA
GAGACAGCCTGTTCAAGTCCAGGATCAATCGAAAGATTCTTCCAGGCAGAGTTGCAGATT
TGTCTTAGATGCTGCCACCCCAATGTCTTACCTGTGCTGGGCTTCTGTGCTGCAAGACAG
TTTCACAGCTTCATCTACCCCTACATGGCAAATGGTTCCCTACAGGACAGACTGCAGGGT
CAGGGTGGCTCGGACCCCCTCCCCTGGCCCCAGCGTGTCAGCATCTGCTCAGGGCTGCTC
TGTGCCGTCGAGTACCTGCATGGTCTGGAGATCATCCACAGCAACGTCAAGAGCTCTAAT
GTCTTGCTGGACCAAAATCTCACCCCCAAACTTGCTCACCCAATGGCTCATCTGTGTCCT
GTCAACAAAAGGTCAAAATACACCATGATGAAGACTCACCTGCTCCGGACGTCAGCCGCG
TATCTGCCAGAGGATTTCATCCGGGTGGGGCAGCTGACAAAGCGAGTGGACATCTTCAGC
TGTGGAATAGTGTTGGCCGAGGTCCTCACGGGCATCCCTGCAATGGATAACAACCGAAGC
CCGGTTTACCTGAAGGACTTACTCCTCAGTGATATTCCAAGCAGCACCGCCTCGCTCTGC
TCCAGGAAGACGGGCGTGGAGAACGTGATGGCAAAGGAGATCTGCCAGAAGTACCTGGAG
AAGGGCGCAGGGAGGCTTCCGGAGGACTGCGCCGAGGCCCTGGCCACGGCTGCCTGCCTG
TGCCTGCGGAGGCGTAACACCAGCCTGCAGGAGGTGTGTGGCTCTGTGGCTGCTGTGGAA
GAGCGGCTCCGAGGTCGGGAGACGTTGCTCCCTTGGAGTGGGCTTTCTGAGGGTACAGGC
TCTTCTTCCAACACCCCAGAGGAAACAGACGACGTTGACAATTCCAGCCTTGATGCCTCC
TCCTCCATGAGTGTGGCACCCTGGGCAGGGGCTGCCACCCCACTTCTCCCCACAGAGAAT
GGGGAAGGAAGGCTGCGGGTCATCGTGGGAAGGGAGGCTGACTCCTCCTCTGAGGCCTGT
GTTGGCCTGGAGCCTCCCCAGGATGTTACAGAAACTTCGTGGCAAATTGAGATCAATGAG
GCCAAAAGGAAACTGATGGAGAATATTCTGCTCTACAAAGAGGAAAAAGTGGACAGCATT
GAGCTCTTTGGCCCCTGA
Protein Properties
Number of Residues 625
Molecular Weight 69432.5
Theoretical pI 5.45
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Interleukin-1 receptor-associated kinase-like 2
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
GenBank ID Protein 58530886
UniProtKB/Swiss-Prot ID O43187
UniProtKB/Swiss-Prot Entry Name IRAK2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001570.3
GeneCard ID IRAK2
GenAtlas ID IRAK2
HGNC ID HGNC:6113
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Wesche H, Gao X, Li X, Kirschning CJ, Stark GR, Cao Z: IRAK-M is a novel member of the Pelle/interleukin-1 receptor-associated kinase (IRAK) family. J Biol Chem. 1999 Jul 2;274(27):19403-10. [PubMed:10383454 ]
  5. Muzio M, Ni J, Feng P, Dixit VM: IRAK (Pelle) family member IRAK-2 and MyD88 as proximal mediators of IL-1 signaling. Science. 1997 Nov 28;278(5343):1612-5. [PubMed:9374458 ]