You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09508
Secondary Accession Numbers
  • 15407
Name Inhibitor of nuclear factor kappa-B kinase subunit epsilon
Synonyms
  1. I-kappa-B kinase epsilon
  2. IKK-E
  3. IKK-epsilon
  4. IKK-i
  5. IkBKE
  6. Inducible I kappa-B kinase
Gene Name IKBKE
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. May play a special role in the immune response. Protects cells against DNA damage- induced cell death
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Nucleus
  3. Cytoplasm
  4. PML body
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32.1
SNPs IKBKE
Gene Sequence
>2151 bp
ATGCAGAGCACAGCCAATTACCTGTGGCACACAGATGACCTGCTGGGGCAGGGGGCCACT
GCCAGTGTGTACAAGGCCCGCAACAAGAAATCCGGAGAGCTGGTTGCTGTGAAGGTCTTC
AACACTACCAGCTACCTGCGGCCCCGCGAGGTGCAGGTGAGGGAGTTTGAGGTCCTGCGG
AAGCTGAACCACCAGAACATCGTCAAGCTCTTTGCGGTGGAGGAGACGGGCGGAAGCCGG
CAGAAGGTACTGGTGATGGAGTACTGCTCCAGTGGGAGCCTGCTGAGTGTGCTGGAGAGC
CCTGAGAATGCCTTTGGGCTGCCTGAGGATGAGTTCCTGGTGGTGCTGCGCTGTGTGGTG
GCCGGCATGAACCACCTGCGGGAGAACGGCATTGTGCATCGCGACATCAAGCCGGGGAAC
ATCATGCGCCTCGTAGGGGAGGAGGGGCAGAGCATCTACAAGCTGACAGACTTCGGCGCT
GCCCGGGAGCTGGATGATGATGAGAAGTTCGTCTCGGTCTATGGGACTGAGGAGTACCTG
CATCCCGACATGTATGAGCGGGCGGTGCTTCGAAAGCCCCAGCAAAAAGCGTTCGGGGTG
ACTGTGGATCTCTGGAGCATTGGAGTGACCTTGTACCATGCAGCCACTGGCAGCCTGCCC
TTCATCCCCTTTGGTGGGCCACGGCGGAACAAGGAGATCATGTACCGGATCACCACAGAG
AAGCCGGCTGGGGCCATTGCAGGTGCCCAGAGGCGGGAGAACGGGCCCCTGGAGTGGAGC
TACACCCTCCCCATCACCTGCCAGCTGTCACTGGGGCTGCAGAGCCAGCTGGTGCCCATC
CTGGCCAACATCCTGGAGGTGGAGCAGGCCAAGTGCTGGGGCTTCGACCAGTTCTTTGCG
GAGACCAGTGACATCCTGCAGCGAGTTGTCGTCCATGTCTTCTCCCTGTCCCAGGCAGTC
CTGCACCACATCTATATCCATGCCCACAACACGATAGCCATTTTCCAGGAGGCCGTGCAC
AAGCAGACCAGTGTGGCCCCCCGACACCAGGAGTACCTCTTTGAGGGTCACCTCTGTGTC
CTCGAGCCCAGCGTCTCAGCACAGCACATCGCCCACACGACGGCAAGCAGCCCCCTGACC
CTCTTCAGCACAGCCATCCCTAAGGGGCTGGCCTTCAGGGACCCTGCTCTGGACGTCCCC
AAGTTCGTCCCCAAAGTGGACCTGCAGGCGGATTACAACACTGCCAAGGGCGTGTTGGGC
GCCGGCTACCAGGCCCTGCGGCTGGCACGGGCCCTGCTGGATGGGCAGGAGCTAATGTTT
CGGGGGCTGCACTGGGTCATGGAGGTGCTCCAGGCCACATGCAGACGGACTCTGGAAGTG
GCAAGGACATCCCTCCTCTACCTCAGCAGCAGCCTGGGAACTGAGAGGTTCAGCAGCGTG
GCTGGAACGCCTGAGATCCAGGAACTGAAGGCGGCTGCAGAACTGAGGTCCAGGCTGCGG
ACTCTAGCGGAGGTCCTCTCCAGATGCTCCCAAAATATCACGGAGACCCAGGAGAGCCTG
AGCAGCCTGAACCGGGAGCTGGTGAAGAGCCGGGATCAGGTACATGAGGACAGAAGCATC
CAGCAGATTCAGTGCTGTTTGGACAAGATGAACTTCATCTACAAACAGTTCAAGAAGTCT
AGGATGAGGCCAGGGCTTGGCTACAACGAGGAGCAGATTCACAAGCTGGATAAGGTGAAT
TTCAGTCATTTAGCCAAAAGACTCCTGCAGGTGTTCCAGGAGGAGTGCGTGCAGAAGTAT
CAAGCGTCCTTAGTCACACACGGCAAGAGGATGAGGGTGGTGCACGAGACCAGGAACCAC
CTGCGCCTGGTTGGCTGTTCTGTGGCTGCCTGTAACACAGAAGCCCAGGGGGTCCAGGAG
AGTCTCAGCAAGCTCCTGGAAGAGCTATCTCACCAGCTCCTTCAGGACCGAGCAAAGGGG
GCTCAGGCCTCGCCGCCTCCCATAGCTCCTTACCCCAGCCCTACACGAAAGGACCTGCTT
CTCCACATGCAAGAGCTCTGCGAGGGGATGAAGCTGCTGGCATCTGACCTCCTGGACAAC
AACCGCATCATCGAACGGCTAAATAGAGTCCCAGCACCTCCTGATGTCTGA
Protein Properties
Number of Residues 716
Molecular Weight 80461.7
Theoretical pI 7.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Inhibitor of nuclear factor kappa-B kinase subunit epsilon
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
GenBank ID Protein 6012176
UniProtKB/Swiss-Prot ID Q14164
UniProtKB/Swiss-Prot Entry Name IKKE_HUMAN
PDB IDs Not Available
GenBank Gene ID AB016590
GeneCard ID IKBKE
GenAtlas ID IKBKE
HGNC ID HGNC:14552
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Nagase T, Seki N, Tanaka A, Ishikawa K, Nomura N: Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995 Aug 31;2(4):167-74, 199-210. [PubMed:8590280 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Han KJ, Su X, Xu LG, Bin LH, Zhang J, Shu HB: Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways. J Biol Chem. 2004 Apr 9;279(15):15652-61. Epub 2004 Jan 22. [PubMed:14739303 ]
  7. Meylan E, Curran J, Hofmann K, Moradpour D, Binder M, Bartenschlager R, Tschopp J: Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus. Nature. 2005 Oct 20;437(7062):1167-72. Epub 2005 Sep 21. [PubMed:16177806 ]
  8. Peters RT, Liao SM, Maniatis T: IKKepsilon is part of a novel PMA-inducible IkappaB kinase complex. Mol Cell. 2000 Mar;5(3):513-22. [PubMed:10882136 ]
  9. Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT: The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response. EMBO Rep. 2008 Sep;9(9):930-6. doi: 10.1038/embor.2008.136. Epub 2008 Jul 18. [PubMed:18636086 ]
  10. Renner F, Moreno R, Schmitz ML: SUMOylation-dependent localization of IKKepsilon in PML nuclear bodies is essential for protection against DNA-damage-triggered cell death. Mol Cell. 2010 Feb 26;37(4):503-15. doi: 10.1016/j.molcel.2010.01.018. [PubMed:20188669 ]
  11. Shimada T, Kawai T, Takeda K, Matsumoto M, Inoue J, Tatsumi Y, Kanamaru A, Akira S: IKK-i, a novel lipopolysaccharide-inducible kinase that is related to IkappaB kinases. Int Immunol. 1999 Aug;11(8):1357-62. [PubMed:10421793 ]
  12. Fujita F, Taniguchi Y, Kato T, Narita Y, Furuya A, Ogawa T, Sakurai H, Joh T, Itoh M, Delhase M, Karin M, Nakanishi M: Identification of NAP1, a regulatory subunit of IkappaB kinase-related kinases that potentiates NF-kappaB signaling. Mol Cell Biol. 2003 Nov;23(21):7780-93. [PubMed:14560022 ]
  13. Huang J, Liu T, Xu LG, Chen D, Zhai Z, Shu HB: SIKE is an IKK epsilon/TBK1-associated suppressor of TLR3- and virus-triggered IRF-3 activation pathways. EMBO J. 2005 Dec 7;24(23):4018-28. Epub 2005 Nov 10. [PubMed:16281057 ]