You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09983
Secondary Accession Numbers
  • 15917
Name Histone acetyltransferase KAT6B
Synonyms
  1. Histone acetyltransferase MORF
  2. Histone acetyltransferase MOZ2
  3. MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4
  4. MYST-4
  5. Monocytic leukemia zinc finger protein-related factor
Gene Name KAT6B
Protein Type Enzyme
Biological Properties
General Function Involved in DNA binding
Specific Function Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Pathways Not Available
Reactions
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
GO Classification
Biological Process
histone H3 acetylation
negative regulation of transcription, DNA-dependent
positive regulation of transcription, DNA-dependent
transcription, DNA-dependent
nucleosome assembly
Cellular Component
MOZ/MORF histone acetyltransferase complex
nucleosome
Component
macromolecular complex
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
nucleosome
protein-dna complex
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
protein binding
nucleic acid binding
dna binding
Molecular Function
metal ion binding
transcription factor binding
zinc ion binding
histone acetyltransferase activity
DNA binding
Process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
nucleosome assembly
nucleosome organization
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location 10
Locus 10q22.2
SNPs MYST4
Gene Sequence
>6222 bp
ATGGTAAAACTTGCAAACCCACTTTATACAGAGTGGATTCTTGAAGCTATACAGAAAATA
AAAAAGCAAAAGCAAAGGCCCTCTGAAGAGAGAATCTGCCATGCGGTCAGTACTTCCCAT
GGGTTGGATAAGAAGACAGTCTCTGAACAGCTGGAACTCAGTGTTCAGGATGGCTCAGTT
CTCAAAGTCACCAACAAAGGCCTTGCCTCCTATAAGGACCCAGACAACCCTGGGCGCTTT
TCATCAGTTAAACCAGGCACTTTTCCTAAGTCAGCCAAGGGGTCTAGAGGATCATGTAAT
GATCTCCGCAATGTGGATTGGAATAAACTTTTAAGGAGAGCAATTGAAGGACTTGAGGAG
CCGAATGGCTCCTCCCTGAAGAACATAGAGAAGTATCTCAGAAGTCAAAGTGATCTCACA
AGCACCACCAACAACCCAGCCTTTCAGCAGCGGCTGCGACTGGGGGCCAAACGCGCTGTG
AATAATGGGAGGTTACTGAAAGACGGACCGCAGTACAGGGTCAATTATGGGAGCTTAGAT
GGCAAAGGGGCACCTCAGTATCCCAGTGCATTCCCATCCTCGCTCCCACCTGTCAGCCTT
CTACCCCATGAGAAAGACCAGCCCCGTGCTGATCCCATTCCAATATGTAGCTTCTGTTTG
GGGACTAAAGAATCAAATCGTGAAAAGAAACCAGAAGAACTCCTCTCTTGTGCAGATTGT
GGCAGTAGTGGACACCCATCCTGTTTGAAATTTTGTCCTGAATTAACAACAAATGTAAAG
GCCTTAAGGTGGCAGTGCATCGAATGCAAGACATGCAGTGCCTGTAGAGTCCAAGGCAGA
AATGCTGATAATATGCTTTTTTGTGATTCCTGTGATAGAGGATTTCATATGGAATGCTGT
GACCCACCACTTTCCAGAATGCCAAAAGGGATGTGGATTTGCCAAGTCTGCAGACCAAAG
AAAAAGGGAAGAAAACTACTTCATGAGAAAGCTGCACAAATAAAACGACGATATGCAAAA
CCCATTGGACGACCGAAAAATAAATTAAAGCAACGATTGTTGTCTGTAACCAGTGATGAA
GGATCCATGAATGCATTCACAGGAAGGGGGTCACCTGGTAGGGGTCAAAAGACTAAAGTC
TGTACCACACCTTCATCTGGTCATGCTGCATCTGGGAAGGACTCAAGCAGCAGATTGGCT
GTTACAGACCCCACTCGGCCTGGTGCCACCACCAAAATCACCACCACCTCCACCTACATT
TCTGCCTCTACACTTAAAGTTAACAAGAAAACCAAAGGGCTCATTGATGGCCTTACTAAG
TTTTTTACACCATCACCTGATGGTCGCAGATCACGAGGTGAAATTATAGACTTTTCAAAG
CACTATCGTCCAAGGAAAAAGGTCTCTCAGAAACAGTCATGCACTTCTCATGTGTTGGCT
ACAGGTACCACACAAAAGCTAAAACCTCCACCTTCTTCACTTCCACCCCCAACCCCCATC
TCCGGTCAGAGCCCCAGTTCACAAAAGTCCAGCACGGCCACTTCTTCTCCCTCTCCCCAG
AGTTCTTCCAGCCAGTGCAGTGTGCCCTCCCTGAGCAGCCTTACCACTAACAGCCAGCTG
AAGGCACTCTTTGATGGGCTTTCTCATATCTATACCACTCAGGGACAGTCTCGCAAAAAG
GGACACCCGAGTTATGCACCACCCAAACGTATGCGTCGTAAAACTGAATTATCTTCCACG
GCAAAATCTAAAGCCCACTTCTTTGGCAAAAGAGATATTAGAAGTCGGTTTATTTCTCAC
TCCTCCTCCTCTAGCTGGGGGATGGCTAGAGGAAGTATTTTTAAAGCAATTGCTCACTTC
AAGCGAACAACTTTCCTTAAAAAGCACAGGATGCTAGGCAGATTAAAATATAAAGTGACC
CCTCAGATGGGGACCCCCTCACCAGGGAAGGGGAGCTTGACAGACGGAAGGATTAAACCT
GATCAGGATGATGATACTGAAATAAAAATAAACATCAAACAAGAAAGTGCAGATGTAAAT
GTGATTGGAAACAAGGATGTCGTTACTGAAGAGGATTTGGATGTTTTTAAGCAGGCCCAG
GAACTTTCTTGGGAGAAAATAGAGTGTGAGAGTGGGGTGGAAGACTGTGGCCGGTACCCT
TCTGTGATTGAATTTGGTAAATATGAAATCCAAACCTGGTACTCCTCGCCTTACCCACAG
GAATATGCAAGATTACCAAAGCTTTACCTGTGTGAATTCTGTCTTAAATATATGAAAAGT
AAAAATATTTTGCTAAGACACTCCAAGAAGTGTGGATGGTTTCATCCTCCAGCAAATGAA
ATTTACCGAAGGAAAGACCTTTCAGTATTTGAGGTTGATGGGAATATGAGCAAAATTTAT
TGCCAAAACCTTTGCTTGTTAGCCAAGCTCTTCCTGGACCACAAAACGTTGTATTATGAT
GTCGAGCCATTCCTTTTTTATGTCCTTACAAAAAATGATGAAAAGGGCTGTCATCTGGTT
GGATACTTCTCTAAGGAAAAGCTTTGCCAGCAGAAGTATAATGTCTCCTGCATAATGATC
ATGCCCCAGCACCAAAGGCAAGGATTTGGACGGTTTCTCATTGATTTCAGCTATTTGCTT
TCTAGAAGAGAAGGCCAAGCAGGGTCTCCTGAAAAGCCTCTCTCCGATCTGGGCCGTCTC
TCCTACCTGGCATATTGGAAGAGCGTCATCTTGGAGTATCTCTACCACCACCATGAGAGG
CACATCAGCATCAAGGCAATTAGCAGAGCGACGGGCATGTGCCCACATGACATTGCCACC
ACTCTGCAGCACCTCCACATGATCGACAAGAGAGATGGCAGATTTGTCATCATTAGACGG
GAAAAGTTGATATTGAGCCACATGGAAAAGCTGAAAACCTGTTCCAGAGCCAATGAACTT
GATCCAGACAGTCTGAGGTGGACCCCAATTTTAATTTCTAATGCTGCAGTGTCTGAAGAA
GAGCGAGAAGCTGAGAAAGAGGCTGAGCGGCTAATGGAACAAGCTAGCTGCTGGGAGAAG
GAGGAACAAGAAATCCTGTCAACTAGAGCTAACAGTAGGCAATCACCTGCAAAAGTACAA
TCGAAAAATAAATATTTGCATTCCCCGGAGAGCCGGCCAGTCACAGGGGAGCGAGGGCAG
CTGCTGGAGCTGTCTAAAGAGAGCAGTGAAGAAGAAGAGGAGGAGGAGGACGAGGAGGAG
GAAGAAGAGGAGGAAGAAGAGGAAGAGGATGAAGAGGAGGAAGAAGAGGAAGAAGAAGAA
GAAGAAGAAGAAAATATTCAAAGCTCTCCCCCAAGATTGACGAAACCACAGTCAGTTGCC
ATAAAGAGAAAGAGGCCTTTTGTACTAAAGAAGAAAAGGGGTCGTAAACGCAGGAGGATC
AACAGCAGTGTAACAACAGAGACCATTTCAGAGACGACAGAAGTACTGAATGAGCCCTTT
GACAACTCAGATGAAGAGAGGCCAATGCCACAGCTGGAGCCTACCTGTGAGATTGAAGTG
GAGGAAGATGGCAGGAAGCCAGTCCTGAGAAAAGCATTCCAGCATCAGCCTGGGAAGAAA
AGACAAACAGAGGAAGAGGAAGGAAAAGACAATCATTGCTTCAAGAATGCTGACCCTTGT
AGAAACAATATGAATGATGATTCAAGTAACTTGAAAGAAGGCAGTAAAGACAATCCCGAA
CCTCTAAAGTGCAAACAAGTGTGGCCAAAAGGAACAAAGCGCGGTCTATCTAAGTGGAGG
CAAAACAAAGAGAGGAAGACCGGATTTAAACTGAATTTGTACACCCCGCCAGAAACACCC
ATGGAGCCTGACGAGCAGGTAACAGTGGAAGAACAGAAGGAGACTTCAGAAGGAAAAACC
AGCCCCAGTCCCATCAGGATTGAGGAGGAGGTCAAGGAAACTGGGGAAGCCCTGTTGCCT
CAAGAGGAAAACAGAAGGGAAGAAACATGTGCCCCTGTAAGTCCAAACACATCACCAGGT
GAAAAACCAGAAGATGATCTCATCAAACCTGAGGAAGAGGAAGAGGAGGAGGAGGAGGAA
GAGGAAGAAGAGGAAGAAGAGGAAGGGGAAGAAGAAGAAGGAGGAGGAAATGTAGAAAAA
GATCCAGATGGTGCTAAAAGCCAAGAAAAAGAGGAACCAGAAATCTCCACGGAAAAAGAA
GACTCTGCACGTTTGGATGATCACGAAGAGGAGGAGGAAGAGGATGAAGAGCCATCCCAC
AACGAGGACCATGATGCCGATGACGAGGATGACAGCCACATGGAGTCTGCCGAAGTGGAG
AAGGAAGAGCTGCCCAGAGAAAGCTTCAAAGAAGTACTGGAAAACCAGGAGACTTTTTTA
GACCTTAATGTGCAGCCTGGTCACTCGAACCCAGAGGTCTTAATGGACTGTGGCGTCGAC
CTGACAGCTTCTTGTAACAGTGAGCCCAAGGAGCTTGCTGGGGACCCTGAAGCTGTACCC
GAATCTGACGAGGAGCCACCCCCAGGAGAACAGGCACAGAAGCAGGACCAAAAGAACAGC
AAGGAAGTCGATACAGAGTTCAAAGAGGGAAACCCAGCAACCATGGAAATCGACTCTGAG
ACTGTCCAGGCCGTTCAGTCTTTGACCCAGGAGAGCAGCGAACAGGACGACACCTTTCAG
GATTGTGCCGAGACTCAAGAGGCCTGTAGAAGCCTACAGAACTACACCCGTGCAGACCAA
AGTCCACAGATTGCCACCACGCTCGACGATTGCCAACAGTCGGACCACAGTAGCCCAGTT
TCATCCGTCCACTCCCATCCTGGCCAGTCCGTACGTTCTGTCAACAGCCCAAGTGTCCCT
GCTCTGGAAAACAGCTACGCCCAAATCAGCCCAGATCAAAGTGCCATCTCAGTGCCATCT
CTGCAGAACATGGAAACCAGTCCCATGATGGATGTCCCATCAGTTTCAGATCATTCACAG
CAAGTCGTAGACAGTGGATTTAGTGACCTGGGCAGTATCGAGAGCACAACTGAGAACTAC
GAAAACCCAAGCAGCTACGATTCTACTATGGGAGGCAGCATCTGTGGAAACGGCTCTTCA
CAGAACAGCTGCTCCTATAGCAACCTCACCTCCAGCAGTCTGACACAGAGCAGCTGTGCT
GTCACCCAGCAGATGTCCAACATCAGCGGGAGCTGCAGCATGCTGCAGCAAACCAGCATC
AGCTCCCCTCCGACCTGCAGCGTCAAGTCTCCTCAAGGCTGTGTGGTGGAGAGGCCTCCG
AGCAGCAGCCAGCAGCTGGCTCAGTGCAGCATGGCTGCTAACTTCACCCCACCCATGCAG
CTGGCTGAAATCCCCGAGACGAGCAACGCCAACATTGGCTTATACGAGCGAATGGGTCAG
AGTGATTTTGGGGCTGGGCATTACCCGCAGCCGTCAGCCACCTTCAGCCTTGCCAAACTG
CAGCAGTTAACTAATACACTTATTGATCATTCATTGCCTTACAGCCATTCCGCTGCTGTG
ACTTCCTATGCAAACAGTGCCTCTTTGTCCACACCATTAAGTAACACAGGGCTTGTTCAA
CTTTCTCAGTCTCCACACTCCGTCCCTGGGGGACCCCAAGCACAAGCTACCATGACCCCA
CCCCCCAACCTGACTCCTCCTCCAATGAATCTGCCGCCGCCTCTTTTGCAACGGAACATG
GCTGCATCAAATATTGGCATCTCTCACAGCCAAAGACTGCAAACCCAGATTGCCAGCAAG
GGCCACATCTCCATGAGAACCAAGTCAGCGTCTCTGTCACCAGCCGCTGCCACCCATCAG
TCACAAATCTATGGGCGCTCCCAGACTGTAGCCATGCAGGGTCCTGCACGGACTTTAACG
ATGCAAAGAGGCATGAACATGAGTGTGAACCTGATGCCAGCGCCAGCCTACAATGTCAAC
TCTGTGAACATGAACATGAACACTCTCAACGCCATGAATGGGTACAGCATGTCCCAGCCA
ATGATGAACAGTGGCTACCACAGCAATCATGGCTATATGAATCAAACGCCCCAATACCCT
ATGCAGATGCAGATGGGCATGATGGGCACCCAGCCATATGCCCAGCAGCCAATGCAGACC
CCACCCCACGGTAACATGATGTACACGGCCCCCGGACATCACGGCTACATGAACACAGGC
ATGTCCAAACAGTCTCTCAATGGCTCCTACATGAGAAGGTAG
Protein Properties
Number of Residues 2073
Molecular Weight 211535.955
Theoretical pI 5.357
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone acetyltransferase MYST4
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSSLTTNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGSIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEDEEE
EEEEEEEEEDEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRI
NSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKK
RQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWR
QNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLP
QEENRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEGEEEEGGGNVEK
DPDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVE
KEELPRESFKEVLENQETFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVP
ESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQ
DCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVP
ALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
ENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSI
SSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETSNANIGLYERMGQ
SDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQ
LSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASK
GHISMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVN
SVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQT
PPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
GenBank ID Protein 100816397
UniProtKB/Swiss-Prot ID Q8WYB5
UniProtKB/Swiss-Prot Entry Name MYST4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012330.2
GeneCard ID MYST4
GenAtlas ID MYST4
HGNC ID HGNC:17582
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Panagopoulos I, Fioretos T, Isaksson M, Samuelsson U, Billstrom R, Strombeck B, Mitelman F, Johansson B: Fusion of the MORF and CBP genes in acute myeloid leukemia with the t(10;16)(q22;p13). Hum Mol Genet. 2001 Feb 15;10(4):395-404. [PubMed:11157802 ]
  6. Doyon Y, Cayrou C, Ullah M, Landry AJ, Cote V, Selleck W, Lane WS, Tan S, Yang XJ, Cote J: ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. Mol Cell. 2006 Jan 6;21(1):51-64. [PubMed:16387653 ]
  7. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  10. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  11. Pelletier N, Champagne N, Stifani S, Yang XJ: MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2. Oncogene. 2002 Apr 18;21(17):2729-40. [PubMed:11965546 ]
  12. Champagne N, Bertos NR, Pelletier N, Wang AH, Vezmar M, Yang Y, Heng HH, Yang XJ: Identification of a human histone acetyltransferase related to monocytic leukemia zinc finger protein. J Biol Chem. 1999 Oct 1;274(40):28528-36. [PubMed:10497217 ]
  13. Ullah M, Pelletier N, Xiao L, Zhao SP, Wang K, Degerny C, Tahmasebi S, Cayrou C, Doyon Y, Goh SL, Champagne N, Cote J, Yang XJ: Molecular architecture of quartet MOZ/MORF histone acetyltransferase complexes. Mol Cell Biol. 2008 Nov;28(22):6828-43. doi: 10.1128/MCB.01297-08. Epub 2008 Sep 15. [PubMed:18794358 ]