You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09986
Secondary Accession Numbers
  • 15921
Name Histone acetyltransferase type B catalytic subunit
Synonyms
  1. SubName: Histone acetyltransferase 1, isoform CRA_b
  2. Histone acetyltransferase 1
Gene Name HAT1
Protein Type Enzyme
Biological Properties
General Function Involved in histone acetyltransferase activity
Specific Function Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage.
Pathways
  • Alcoholism
Reactions
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
GO Classification
Biological Process
DNA packaging
response to nutrient
chromatin silencing at telomere
Cellular Component
cytoplasm
nucleus
nucleoplasm
nuclear matrix
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
n-acetyltransferase activity
lysine n-acetyltransferase activity
histone acetyltransferase activity
Molecular Function
histone acetyltransferase activity
Process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
chromatin modification
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q31.2-q33.1
SNPs HAT1
Gene Sequence
>1005 bp
ATGTTCCGTGTTGAATATGCATCTAAAGTTGATGAGAACTTTGACTGTGTAGAGGCAGAT
GATGTTGAGGGCAAAATTAGACAAATCATTCCACCTGGATTTTGCACAAACACGAATGAT
TTCCTTTCTTTACTGGAAAAGGAAGTTGATTTCAAGCCATTCGGAACCTTACTTCATACC
TACTCAGTTCTCAGTCCAACAGGAGGAGAAAACTTTACCTTTCAGATATATAAGGCTGAC
ATGACATGTAGAGGCTTTCGAGAATATCATGAAAGGCTTCAGACCTTTTTGATGTGGTTT
ATTGAAACTGCTAGCTTTATTGACGTGGATGATGAAAGATGGCACTACTTTCTAGTATTT
GAGAAGTATAATAAGGATGGAGCTACGCTCTTTGCGACCGTAGGCTACATGACAGTCTAT
AATTACTATGTGTACCCAGACAAAACCCGGCCACGTGTAAGTCAGATGCTGATTTTGACT
CCATTTCAAGGTCAAGGCCATGGTGCTCAACTTCTTGAAACAGTTCATAGATACTACACT
GAATTTCCTACAGTTCTTGATATTACAGCGGAAGATCCATCCAAAAGCTATGTGAAATTA
CGAGACTTTGTGCTTGTGAAGCTTTGTCAAGATTTGCCCTGTTTTTCCCGGGAAAAATTA
ATGCAAGGATTCAATGAAGATATGGCGATAGAGGCACAACAGAAGTTCAAAATAAATAAG
CAACACGCTAGAAGGGTTTATGAAATTCTTCGACTACTGGTAACTGACATGAGTGATGCC
GAACAATACAGAAGCTACAGACTGGATATTAAAAGAAGACTAATTAGCCCATATAAGAAA
AAGCAGAGAGATCTTGCTAAGATGAGAAAATGTCTCAGACCAGAAGAACTGACAAACCAG
ATGAACCAAATAGAAATAAGCATGCAACATGAACAGCTGGAAGAGAGTTTTCAGGAACTA
GTGGAAGATTACCGGCGTGTTATTGAACGACTTGCTCAAGAGTAA
Protein Properties
Number of Residues 334
Molecular Weight 49512.19
Theoretical pI 5.699
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone acetyltransferase 1
MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHT
YSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVF
EKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYT
EFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINK
QHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ
MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
GenBank ID Protein 38614185
UniProtKB/Swiss-Prot ID O14929
UniProtKB/Swiss-Prot Entry Name Q6P594_HUMAN
PDB IDs
GenBank Gene ID BC063003
GeneCard ID HAT1
GenAtlas ID HAT1
HGNC ID HGNC:4821
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Venter JC, Adams MD, Myers EW, Li PW, Mural RJ, Sutton GG, Smith HO, Yandell M, Evans CA, Holt RA, Gocayne JD, Amanatides P, Ballew RM, Huson DH, Wortman JR, Zhang Q, Kodira CD, Zheng XH, Chen L, Skupski M, Subramanian G, Thomas PD, Zhang J, Gabor Miklos GL, Nelson C, Broder S, Clark AG, Nadeau J, McKusick VA, Zinder N, Levine AJ, Roberts RJ, Simon M, Slayman C, Hunkapiller M, Bolanos R, Delcher A, Dew I, Fasulo D, Flanigan M, Florea L, Halpern A, Hannenhalli S, Kravitz S, Levy S, Mobarry C, Reinert K, Remington K, Abu-Threideh J, Beasley E, Biddick K, Bonazzi V, Brandon R, Cargill M, Chandramouliswaran I, Charlab R, Chaturvedi K, Deng Z, Di Francesco V, Dunn P, Eilbeck K, Evangelista C, Gabrielian AE, Gan W, Ge W, Gong F, Gu Z, Guan P, Heiman TJ, Higgins ME, Ji RR, Ke Z, Ketchum KA, Lai Z, Lei Y, Li Z, Li J, Liang Y, Lin X, Lu F, Merkulov GV, Milshina N, Moore HM, Naik AK, Narayan VA, Neelam B, Nusskern D, Rusch DB, Salzberg S, Shao W, Shue B, Sun J, Wang Z, Wang A, Wang X, Wang J, Wei M, Wides R, Xiao C, Yan C, Yao A, Ye J, Zhan M, Zhang W, Zhang H, Zhao Q, Zheng L, Zhong F, Zhong W, Zhu S, Zhao S, Gilbert D, Baumhueter S, Spier G, Carter C, Cravchik A, Woodage T, Ali F, An H, Awe A, Baldwin D, Baden H, Barnstead M, Barrow I, Beeson K, Busam D, Carver A, Center A, Cheng ML, Curry L, Danaher S, Davenport L, Desilets R, Dietz S, Dodson K, Doup L, Ferriera S, Garg N, Gluecksmann A, Hart B, Haynes J, Haynes C, Heiner C, Hladun S, Hostin D, Houck J, Howland T, Ibegwam C, Johnson J, Kalush F, Kline L, Koduru S, Love A, Mann F, May D, McCawley S, McIntosh T, McMullen I, Moy M, Moy L, Murphy B, Nelson K, Pfannkoch C, Pratts E, Puri V, Qureshi H, Reardon M, Rodriguez R, Rogers YH, Romblad D, Ruhfel B, Scott R, Sitter C, Smallwood M, Stewart E, Strong R, Suh E, Thomas R, Tint NN, Tse S, Vech C, Wang G, Wetter J, Williams S, Williams M, Windsor S, Winn-Deen E, Wolfe K, Zaveri J, Zaveri K, Abril JF, Guigo R, Campbell MJ, Sjolander KV, Karlak B, Kejariwal A, Mi H, Lazareva B, Hatton T, Narechania A, Diemer K, Muruganujan A, Guo N, Sato S, Bafna V, Istrail S, Lippert R, Schwartz R, Walenz B, Yooseph S, Allen D, Basu A, Baxendale J, Blick L, Caminha M, Carnes-Stine J, Caulk P, Chiang YH, Coyne M, Dahlke C, Mays A, Dombroski M, Donnelly M, Ely D, Esparham S, Fosler C, Gire H, Glanowski S, Glasser K, Glodek A, Gorokhov M, Graham K, Gropman B, Harris M, Heil J, Henderson S, Hoover J, Jennings D, Jordan C, Jordan J, Kasha J, Kagan L, Kraft C, Levitsky A, Lewis M, Liu X, Lopez J, Ma D, Majoros W, McDaniel J, Murphy S, Newman M, Nguyen T, Nguyen N, Nodell M, Pan S, Peck J, Peterson M, Rowe W, Sanders R, Scott J, Simpson M, Smith T, Sprague A, Stockwell T, Turner R, Venter E, Wang M, Wen M, Wu D, Wu M, Xia A, Zandieh A, Zhu X: The sequence of the human genome. Science. 2001 Feb 16;291(5507):1304-51. [PubMed:11181995 ]