You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10018
Secondary Accession Numbers
  • 15957
Name A disintegrin and metalloproteinase with thrombospondin motifs 2
Synonyms
  1. ADAM-TS 2
  2. ADAM-TS2
  3. ADAMTS-2
  4. PC I-NP
  5. Procollagen I N-proteinase
  6. Procollagen I/II amino propeptide-processing enzyme
  7. Procollagen N-endopeptidase
  8. pNPI
Gene Name ADAMTS2
Protein Type Enzyme
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
proteinaceous extracellular matrix
Function
endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metalloendopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:5
Locus 5qter
SNPs ADAMTS2
Gene Sequence
>3636 bp
ATGGATCCGCCGGCGGGAGCCGCTCGCCGCCTGCTCTGCCCCGCGCTGCTGCTGCTGCTG
CTGCTGCTGCCGCCGCCGCTCCTGCCGCCGCCGCCGCCGCCCGCGAACGCCAGGCTCGCC
GCCGCCGCCGACCCCCCAGGCGGGCCCCTGGGGCACGGAGCGGAGCGCATCCTGGCGGTG
CCCGTGCGCACTGACGCCCAGGGCCGCTTGGTGTCCCACGTGGTGTCGGCAGCTACGTCC
AGAGCAGGGGTACGAGCCCGCAGGGCCGCCCCGGTCCGGACCCCGAGCTTCCCCGGAGGC
AACGAGGAGGAGCCTGGCAGTCACCTCTTCTACAATGTCACGGTCTTTGGCCGAGACCTG
CACCTGCGGCTGCGGCCCAACGCCCGCCTCGTGGCGCCCGGGGCCACTATGGAGTGGCAG
GGCGAGAAGGGCACCACCCGCGTGGAGCCCCTGCTCGGGAGCTGTCTCTACGTCGGAGAC
GTGGCCGGCCTAGCCGAAGCCTCCTCTGTGGCGCTCAGCAACTGCGATGGGCTGGCTGGT
CTGATCCGGATGGAGGAGGAGGAGTTCTTCATCGAACCCTTGGAGAAGGGGCTGGCGGCG
CAGGAGGCTGAGCAAGGCCGTGTGCATGTGGTGTATCGCCGGCCACCCACGTCCCCTCCT
CTCGGGGGGCCACAGGCCCTGGACACAGGGGCCTCCCTGGACAGCCTGGACAGCCTCAGC
CGCGCCCTGGGCGTCCTAGAGGAGCACGCCAACAGCTCGAGGCGGAGGGCACGCAGGCAT
GCTGCGGACGATGACTACAACATCGAGGTCCTGCTGGGCGTGGATGACTCTGTGGTGCAG
TTCCACGGGAAGGAGCACGTACAGAAGTACCTGCTGACACTCATGAACATTGTCAATGAA
ATCTACCATGACGAGTCCTTGGGTGCCCACATCAACGTGGTCCTGGTGCGGATCATCCTC
CTGAGCTATGGAAAGTCCATGAGCCTCATCGAGATCGGGAACCCCTCTCAGAGCCTGGAG
AATGTCTGCCGCTGGGCCTACCTCCAGCAGAAGCCAGACACGGGCCACGATGAATACCAC
GATCACGCCATCTTCCTCACACGGCAGGACTTTGGGCCTTCCGGCATGCAAGGCTATGCT
CCTGTCACCGGCATGTGCCATCCGGTCCGCAGCTGCACCCTGAACCATGAGGACGGCTTC
TCCTCAGCGTTTGTGGTGGCCCATGAGACTGGCCACGTGCTGGGCATGGAGCACGACGGG
CAGGGCAACCGCTGTGGCGACGAGGTGCGGCTGGGCAGCATCATGGCGCCCCTGGTGCAG
GCCGCCTTCCACCGCTTCCACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTG
CACTCCTATGACTGCCTGCTGGATGACCCCTTCGCCCACGACTGGCCGGCGCTGCCCCAG
CTCCCGGGACTGCACTACTCCATGAACGAGCAATGCCGCTTTGACTTCGGCCTGGGCTAC
ATGATGTGCACGGCGTTCCGGACCTTTGACCCCTGCAAGCAGCTGTGGTGCAGCCATCCT
GACAACCCCTACTTTTGCAAGACCAAGAAGGGGCCCCCCTTGGACGGGACTATGTGTGCA
CCTGGCAAGCATTGTTTTAAAGGACACTGCATCTGGCTGACACCTGACATCCTCAAACGG
GACGGCAGCTGGGGCGCTTGGAGTCCGTTTGGCTCCTGCTCACGTACCTGTGGCACGGGC
GTGAAGTTCAGGACCCGCCAGTGTGACAACCCACACCCGGCCAACGGGGGCCGCACCTGC
TCGGGCCTTGCCTACGACTTCCAGCTCTGCAGCCGCCAGGACTGCCCCGACTCCCTGGCT
GACTTCCGCGAGGAGCAGTGCCGCCAGTGGGACCTGTACTTCGAGCACGGCGACGCCCAG
CACCACTGGCTGCCCCACGAGCACCGGGATGCCAAGGAGAGATGCCACCTGTACTGCGAG
TCCAGGGAGACCGGGGAGGTGGTGTCCATGAAGCGCATGGTGCATGACGGGACGCGCTGC
TCCTACAAGGACGCCTTCAGCCTCTGTGTGCGCGGGGACTGCAGGAAGGTGGGCTGTGAC
GGTGTGATCGGCTCCAGCAAGCAGGAAGACAAGTGTGGCGTGTGCGGAGGGGACAACAGC
CACTGCAAAGTGGTCAAGGGCACGTTCACACGGTCACCCAAGAAGCATGGTTACATCAAG
ATGTTTGAGATCCCTGCAGGAGCCAGACACCTGCTCATTCAGGAGGTAGACGCCACCAGC
CACCATCTGGCCGTCAAGAACCTGGAGACAGGCAAGTTCATCTTAAATGAAGAGAATGAC
GTGGATGCCAGTTCCAAAACCTTCATTGCCATGGGCGTGGAGTGGGAGTACAGAGACGAG
GACGGCCGGGAGACGCTGCAGACCATGGGCCCCCTCCACGGCACCATCACCGTTCTGGTC
ATCCCGGTGGGAGACACCCGGGTCTCACTGACGTACAAATACATGATCCATGAGGACTCA
CTGAATGTCGACGACAACAACGTCCTGGAAGAGGACTCTGTGGTCTACGAGTGGGCCCTG
AAGAAGTGGTCTCCGTGCTCCAAGCCCTGTGGCGGAGGGTCCCAGTTCACCAAGTATGGC
TGCCGCCGGAGGCTGGACCACAAGATGGTACACCGTGGCTTCTGTGCCGCCCTCTCGAAG
CCCAAAGCCATCCGCAGAGCGTGCAACCCACAGGAATGCTCCCAGCCAGTGTGGGTCACA
GGCGAATGGGAGCCATGTAGCCAGACCTGTGGGCGGACAGGCATGCAGGTGCGCTCCGTG
CGCTGCATTCAGCCGCTACACGACAACACCACCCGCTCCGTGCACGCCAAGCACTGCAAT
GACGCCCGGCCCGAGAGCCGCCGGGCCTGCAGCCGCGAGCTCTGCCCTGGTCGTTGGCGA
GCCGGGCCCTGGTCCCAGTGCTCAGTAACCTGTGGCAACGGCACCCAGGAGCGGCCAGTG
CTCTGCCGCACCGCGGACGACAGCTTCGGCATCTGCCAGGAGGAGCGTCCTGAGACAGCG
AGGACCTGCAGGCTTGGCCCCTGTCCCCGAAACATCTCAGATCCCTCCAAGAAGAGCTAC
GTAGTTCAGTGGCTGTCCCGCCCGGACCCCGACTCGCCCATCCGGAAGATCTCGTCAAAG
GGCCACTGCCAAGGCGACAAGTCAATATTCTGTAGGATGGAAGTCTTGTCCCGCTATTGC
TCCATCCCAGGCTACAACAAGCTGTGCTGCAAGTCCTGTAACCTGTACAACAACCTCACC
AACGTGGAGGGCAGGATAGAGCCACCGCCTGGGAAGCACAACGACATTGACGTGTTCATG
CCTACCCTCCCAGTGCCCACTGTAGCCATGGAGGTGCGGCCATCACCAAGCACCCCCCTG
GAGGTCCCTCTCAATGCCTCCAGCACCAATGCCACAGAGGATCACCCAGAAACCAATGCC
GTAGATGAACCCTACAAAATCCATGGCCTGGAAGATGAAGTCCAGCCACCCAACCTAATC
CCTCGACGACCGAGCCCCTATGAAAAGACCAGAAACCAAAGAATCCAAGAGCTCATTGAT
GAGATGCGGAAGAAAGAGATGCTCGGAAAGTTCTAA
Protein Properties
Number of Residues 1211
Molecular Weight 134753.7
Theoretical pI 7.15
Pfam Domain Function
Signals
  • 1-29
Transmembrane Regions
  • None
Protein Sequence
>A disintegrin and metalloproteinase with thrombospondin motifs 2
MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAV
PVRTDAQGRLVSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDL
HLRLRPNARLVAPGATMEWQGEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAG
LIRMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLS
RALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNE
IYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYH
DHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDG
QGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQ
LPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCA
PGKHCFKGHCIWLTPDILKRDGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTC
SGLAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCE
SRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNS
HCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLETGKFILNEEND
VDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDS
LNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSK
PKAIRRACNPQECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCN
DARPESRRACSRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETA
RTCRLGPCPRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYC
SIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPL
EVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELID
EMRKKEMLGKF
GenBank ID Protein 110825974
UniProtKB/Swiss-Prot ID O95450
UniProtKB/Swiss-Prot Entry Name ATS2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014244.4
GeneCard ID ADAMTS2
GenAtlas ID ADAMTS2
HGNC ID HGNC:218
References
General References
  1. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  2. Colige A, Sieron AL, Li SW, Schwarze U, Petty E, Wertelecki W, Wilcox W, Krakow D, Cohn DH, Reardon W, Byers PH, Lapiere CM, Prockop DJ, Nusgens BV: Human Ehlers-Danlos syndrome type VII C and bovine dermatosparaxis are caused by mutations in the procollagen I N-proteinase gene. Am J Hum Genet. 1999 Aug;65(2):308-17. [PubMed:10417273 ]