You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10109
Secondary Accession Numbers
  • 16061
Name Carboxymethylenebutenolidase homolog
Synonyms Not Available
Gene Name CMBL
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity
Specific Function Cysteine hydrolase. Can convert the prodrug olmesartan medoxomil into its pharmacologically active metabolite olmerstatan, an angiotensin receptor blocker, in liver and intestine. May also activate beta-lactam antibiotics faropenem medoxomil and lenampicillin.
Pathways Not Available
Reactions
cis-4-Carboxymethylenebut-2-en-4-olide + Water → 2-Maleylacetate details
Protoanemonin + Water → cis-Acetylacrylate details
cis-2-Chloro-4-carboxymethylenebut-2-en-1,4-olide + Water → 2-Chloromaleylacetate details
2,5-Dichloro-carboxymethylenebut-2-en-4-olide + Water → 2,5-Dichloro-4-oxohex-2-enedioate details
trans-4-Carboxymethylenebut-2-en-4-olide + Water → 2-Maleylacetate details
5-Fluoromuconolactone + Water → 2-Maleylacetate + Fluoride details
4-Fluoromuconolactone + Water → 2-Maleylacetate + Fluoride details
2,3,5-Trichlorodienelactone + Water → 2,3,5-Trichloromaleylacetate details
3-Chloro-2-methyldienelactone + Water → 3-Chloro-2-methylmaleylacetate details
2-Chloro-5-methyl-cis-dienelactone + Water → 2-Chloro-5-methylmaleylacetate details
GO Classification
Cellular Component
cytosol
Function
catalytic activity
hydrolase activity
Molecular Function
hydrolase activity
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs CMBL
Gene Sequence
>738 bp
ATGGCTAACGAAGCTTATCCTTGTCCGTGTGACATTGGCCACAGACTTGAGTATGGAGGG
CTAGGCCGTGAAGTTCAAGTCGAGCACATCAAGGCTTATGTCACCAAATCCCCCGTTGAT
GCAGGCAAAGCTGTGATTGTCATTCAAGATATATTTGGCTGGCAGTTGCCCAATACCAGA
TATATAGCTGACATGATCTCAGGAAATGGATACACAACCATTGTTCCAGACTTCTTTGTA
GGGCAAGAGCCTTGGGACCCCTCTGGCGACTGGTCTATCTTCCCTGAGTGGCTGAAAACA
AGAAATGCCCAGAAGATCGATAGAGAGATCAGTGCTATCTTGAAGTATCTGAAACAACAG
TGTCATGCCCAGAAAATTGGCATCGTGGGATTCTGCTGGGGTGGAACTGCTGTCCATCAT
TTGATGATGAAATACTCAGAATTCAGGGCAGGGGTGTCCGTCTATGGCATTGTCAAGGAT
TCTGAAGACATTTACAATTTAAAGAACCCCACTTTGTTCATTTTTGCTGAAAATGATGTT
GTGATTCCACTCAAGGACGTATCTTTGCTGACTCAGAAGTTGAAAGAACACTGCAAAGTT
GAATATCAAATTAAAACATTTTCTGGGCAGACTCATGGGTTCGTGCATCGGAAGAGAGAA
GATTGCTCACCTGCAGACAAGCCCTACATTGACGAGGCCAGAAGGAATTTAATTGAGTGG
CTGAACAAGTACATGTAG
Protein Properties
Number of Residues 245
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carboxymethylenebutenolidase homolog
MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTR
YIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQ
CHAQKIGIVGFCWGGTAVHHLMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDV
VIPLKDVSLLTQKLKEHCKVEYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEW
LNKYM
GenBank ID Protein 27526513
UniProtKB/Swiss-Prot ID Q96DG6
UniProtKB/Swiss-Prot Entry Name CMBL_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ278125
GeneCard ID CMBL
GenAtlas ID CMBL
HGNC ID HGNC:25090
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Ishizuka T, Fujimori I, Kato M, Noji-Sakikawa C, Saito M, Yoshigae Y, Kubota K, Kurihara A, Izumi T, Ikeda T, Okazaki O: Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine. J Biol Chem. 2010 Apr 16;285(16):11892-902. doi: 10.1074/jbc.M109.072629. Epub 2010 Feb 19. [PubMed:20177059 ]